Regulator of G-protein signaling 17 (Rgs17) Recombinant Protein | Rgs17 recombinant protein
Recombinant Mouse Regulator of G-protein signaling 17 (Rgs17)
Gene Names
Rgs17; Rgsz2; 6430507P11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regulator of G-protein signaling 17 (Rgs17); Recombinant Mouse Regulator of G-protein signaling 17 (Rgs17); Rgs17 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-210, full length protein
Sequence
MRKRQQSQNEGTQAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGDSSGRSPHTTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVINRSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVESTTSCTSES
Sequence Length
210
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rgs17 recombinant protein
This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta
gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.
gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,345 Da
NCBI Official Full Name
regulator of G-protein signaling 17 isoform 1
NCBI Official Synonym Full Names
regulator of G-protein signaling 17
NCBI Official Symbol
Rgs17
NCBI Official Synonym Symbols
Rgsz2; 6430507P11Rik
NCBI Protein Information
regulator of G-protein signaling 17
UniProt Protein Name
Regulator of G-protein signaling 17
Protein Family
UniProt Gene Name
Rgs17
UniProt Synonym Gene Names
; RGS17
Uniprot Description
Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2 (). Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
Research Articles on Rgs17
Similar Products
Product Notes
The Rgs17 rgs17 (Catalog #AAA1285239) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-210, full length protein. The amino acid sequence is listed below: MRKRQQSQNE GTQAVSQAPG NQRPNNTCCF CWCCCCSCSC LTVRNEERGD SSGRSPHTTK MESIQVLEEC QNPTADEVLS WSQNFDKMMK TPAGRNLFRE FLRTEYSEEN LLFWLACEDL KKEQNKKAVE EKARMIYEDY ISILSPKEVS LDSRVREVIN RSLLDPSPHM YEDAQLQIYT LMHRDSFPRF LNSQIYKAFV ESTTSCTSES. It is sometimes possible for the material contained within the vial of "Regulator of G-protein signaling 17 (Rgs17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
