Rabbit anti-Mouse, Rat RGS17 Polyclonal Antibody | anti-RGS17 antibody

RGS17 Polyclonal Antibody

Cat. Num. AAA9140526

• Gene Names: RGS17; RGSZ2; RGS-17; hRGS17
• Reactivity: Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: RGS17; Polyclonal Antibody; RGS17 Polyclonal Antibody; RGS-17; RGSZ2; hRGS17; regulator of G-protein signaling 17; anti-RGS17 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 3.87 mg/ml (varies by lot)
• Sequence Length: 210

• Applicable Applications for anti-RGS17 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 45-130 of human RGS17 (NP_036551.3).
• Immunogen Sequence: NEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIE
• Positive Samples: Mouse Brain, Rat Brain
• Cellular Location: Cytoplasm, Lipid-Anchor, Membrane, Nucleus
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RGS17 Polyclonal Antibody)

Related Product Information for anti-RGS17 antibody

This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.

NCBI and Uniprot Product Information

• NCBI GI #: 21361405
• NCBI GeneID: 26575
• NCBI Accession #: NP_036551.3
• NCBI GenBank Nucleotide #: NP_036551.3
• UniProt Accession #: Q9UGC6
• Molecular Weight: Calculated: 24kDa; Observed: 24kDa
• NCBI Official Full Name: regulator of G-protein signaling 17
• NCBI Official Synonym Full Names: regulator of G protein signaling 17
• NCBI Official Symbol: RGS17
• NCBI Official Synonym Symbols: RGSZ2; RGS-17; hRGS17
• NCBI Protein Information: regulator of G-protein signaling 17
• UniProt Protein Name: Regulator of G-protein signaling 17
• Protein Family: Regulator of G-protein signaling
• UniProt Gene Name: RGS17
• UniProt Synonym Gene Names: RGS17
• UniProt Entry Name: RGS17_HUMAN

NCBI Description

This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. [provided by RefSeq, Jul 2008]

Uniprot Description

RGS17: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G- protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.

Protein type: GAPs; GAPs, RGS

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: cytoplasm; plasma membrane; nucleus

Molecular Function: GTPase activator activity

Biological Process: positive regulation of GTPase activity