SDS-Page
Repulsive Guidance Molecule A (RGMA) Recombinant Protein | RGMA recombinant protein
Recombinant Human Repulsive Guidance Molecule A (RGMA)
Gene Names
RGMA; RGM
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Repulsive Guidance Molecule A (RGMA); Recombinant Human Repulsive Guidance Molecule A (RGMA); RGM domain family member A; RGM; RGMA recombinant protein
Host
Baculovirus
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
169-424aa; Full Length of Mature Protein
Sequence
PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGRA
Sequence Length
450
Species
Human
Tag
N-terminal MBP-tagged and C-terminal 6xHis-tagged
Subcellular Location
Cell Membrane, Lipid-Anchor, GPI-Anchor
Protein Families
Repulsive guidance molecule (RGM) family
Production Note
Special Offer: The Baculovirus host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirushost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-Page
SDS-Page
Related Product Information for RGMA recombinant protein
Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8.
Product Categories/Family for RGMA recombinant protein
References
"Inactivation of Ras by p120GAP via focal adhesion kinase dephosphorylation mediates RGMa-induced growth cone collapse." Endo M., Yamashita T. J. Neurosci. 29:6649-6662(2009).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
72.5 kDa
NCBI Official Full Name
Repulsive guidance molecule A
NCBI Official Synonym Full Names
repulsive guidance molecule BMP co-receptor a
NCBI Official Symbol
RGMA
NCBI Official Synonym Symbols
RGM
NCBI Protein Information
repulsive guidance molecule A
UniProt Protein Name
Repulsive guidance molecule A
Protein Family
UniProt Gene Name
RGMA
UniProt Synonym Gene Names
RGM
UniProt Entry Name
RGMA_HUMAN
NCBI Description
This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein may also function as a tumor suppressor in some cancers. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Research Articles on RGMA
Similar Products
Product Notes
The RGMA rgma (Catalog #AAA7115327) is a Recombinant Protein produced from Baculovirus and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 169-424aa; Full Length of Mature Protein. The amino acid sequence is listed below: PHLRTFTDRF QTCKVQGAWP LIDNNYLNVQ VTNTPVLPGS AATATSKLTI IFKNFQECVD QKVYQAEMDE LPAAFVDGSK NGGDKHGANS LKITEKVSGQ HVEIQAKYIG TTIVVRQVGR YLTFAVRMPE EVVNAVEDWD SQGLYLCLRG CPLNQQIDFQ AFHTNAEGTG ARRLAAASPA PTAPETFPYE TAVAKCKEKL PVEDLYYQAC VFDLLTTGDV NFTLAAYYAL EDVKMLHSNK DKLHLYERTR DLPGRA. It is sometimes possible for the material contained within the vial of "Repulsive Guidance Molecule A (RGMA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
