dITP/XTP pyrophosphatase (rdgB) Recombinant Protein | rdgB recombinant protein

Recombinant Escherichia coli dITP/XTP pyrophosphatase (rdgB)

Cat. Num. AAA1250677

• Gene Names: rdgB; ECK2949; JW2921; yggV
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: dITP/XTP pyrophosphatase (rdgB); Recombinant Escherichia coli dITP/XTP pyrophosphatase (rdgB); rdgB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-197aa; Full Length
• Sequence: MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG
• Sequence Length: 197

• Species: Escherichia coli (strain K12)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for rdgB recombinant protein

Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA
RNA and avoiding chromosomal lesions.To a much lesser extent,is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate

References

"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 16130855
• NCBI GeneID: 947429
• NCBI Accession #: NP_417429.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P52061; Q2M9N9
• Molecular Weight: 41.0 kDa
• NCBI Official Full Name: dITP/XTP pyrophosphatase
• NCBI Official Symbol: rdgB
• NCBI Official Synonym Symbols: ECK2949; JW2921; yggV
• NCBI Protein Information: dITP/XTP pyrophosphatase
• UniProt Protein Name: dITP/XTP pyrophosphatase
• Protein Family: DNA-binding protein
• UniProt Gene Name: rdgB
• UniProt Synonym Gene Names: NTPase

NCBI Description

2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP) is a preferred substrate (Burgis, 2006). [More information is available at EcoGene: EG12982]. Purified RdgB exhibits nucleoside triphosphatase activity toward deoxyinosine triphosphate (dITP) and xanthosine triphosphate (XTP), mutagenic products of purine nucleotide deamination, and may therefore act to reduce the abundance of nucleotides that can be misincorporated during DNA replication . [More information is available at EcoCyc: G7530].

Uniprot Description

Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP (PubMed:12297000, PubMed:17976651). Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP) (PubMed:17090528). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions (PubMed:12297000, PubMed:12730170, PubMed:17090528). To a much lesser extent, is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate (PubMed:12297000, PubMed:17090528).