Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Altered inheritance of mitochondria protein 31, mitochondrial (aim31) Recombinant Protein | NFIA_108070 recombinant protein

Recombinant Neosartorya fischeri Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Altered inheritance of mitochondria protein 31; mitochondrial (aim31); Recombinant Neosartorya fischeri Altered inheritance of mitochondria protein 31; Recombinant Altered inheritance of mitochondria protein 31; mitochondrial; NFIA_108070 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-181
Sequence
MLNEPLPSSMEDNPQFKEETSLQKFRRRLKEEPLIPLGCAATCYALYRAYRSMKAGDSVEMNKMFRARIYAQFFTLVAVVAGGMYFKTERQQRREFEKMVEQRKAQEKRDAWLRELEIRDKEDKDWRERHAAIEAAAKEAGKRPAPNKIPEQDAARSAIEPADEKSIGVLAAVRDLWMQQK
Sequence Length
181
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,099 Da
NCBI Official Full Name
mitochondrial hypoxia responsive domain protein
NCBI Official Symbol
NFIA_108070
NCBI Protein Information
mitochondrial hypoxia responsive domain protein
UniProt Protein Name
Respiratory supercomplex factor 1, mitochondrial
UniProt Gene Name
rcf1
UniProt Synonym Gene Names
aim31
UniProt Entry Name
RCF1_NEOFI

Uniprot Description

Function: Cytochrome c oxidase subunit which plays a role in assembly of respiratory supercomplexes

By similarity.

Subunit structure: Associates with the respiratory chain complex III/complex IV supercomplex

By similarity.

Subcellular location: Mitochondrion membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the RCF1 family.Contains 1 HIG1 domain.

Similar Products

Product Notes

The NFIA_108070 rcf1 (Catalog #AAA1029796) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-181. The amino acid sequence is listed below: MLNEPLPSSM EDNPQFKEET SLQKFRRRLK EEPLIPLGCA ATCYALYRAY RSMKAGDSVE MNKMFRARIY AQFFTLVAVV AGGMYFKTER QQRREFEKMV EQRKAQEKRD AWLRELEIRD KEDKDWRERH AAIEAAAKEA GKRPAPNKIP EQDAARSAIE PADEKSIGVL AAVRDLWMQQ K. It is sometimes possible for the material contained within the vial of "Altered inheritance of mitochondria protein 31, mitochondrial (aim31), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.