Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human CABIN1 Monoclonal Antibody | anti-CABIN1 antibody

CABIN1 (Calcineurin-binding Protein Cabin-1, Calcineurin Inhibitor, CAIN, KIAA0330) (FITC)

Gene Names
CABIN1; CAIN; PPP3IN; KB-318B8.7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CABIN1; Monoclonal Antibody; CABIN1 (Calcineurin-binding Protein Cabin-1; Calcineurin Inhibitor; CAIN; KIAA0330) (FITC); anti-CABIN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G2
Specificity
Recognizes human CABIN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CABIN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from CABIN1 (NP_036427) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)
Related Product Information for anti-CABIN1 antibody
Calcineurin is a widely distributed Ser/Thr, calcium and calmodulin-dependent protein phosphatase. It mediates the immunosuppressive actions of drugs such as FK506 and cyclosporin, and has also been implicated in a number of calcium-sensitive pathways in the nervous system. Calcineurin has been found to be associated with other proteins, such as calmodulin, FKBP12, the ryanodine receptor, inositol 1,4,5-trisphosphate, and a recently identified protein, calcineurin inhibitor (CAIN). CAIN has been shown to bind calcineurin through its C-terminal tail. Recent studies have shown CAIN to bind to both amphiphysin 1 and calcineurin simultaneously and therefore acts as a physiological inhibitor of calcineurin. The binding of CAIN to amphiphysin 1 does not affect the interaction of amphiphysin 1 with other endocytic proteins. CAIN, like calcineurin, is highly expressed in neurons and other tissues.
Product Categories/Family for anti-CABIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
237,574 Da
NCBI Official Full Name
calcineurin-binding protein cabin-1 isoform a
NCBI Official Synonym Full Names
calcineurin binding protein 1
NCBI Official Symbol
CABIN1
NCBI Official Synonym Symbols
CAIN; PPP3IN; KB-318B8.7
NCBI Protein Information
calcineurin-binding protein cabin-1
UniProt Protein Name
Calcineurin-binding protein cabin-1
UniProt Gene Name
CABIN1
UniProt Synonym Gene Names
KIAA0330; CAIN
UniProt Entry Name
CABIN_HUMAN

NCBI Description

Calcineurin plays an important role in the T-cell receptor-mediated signal transduction pathway. The protein encoded by this gene binds specifically to the activated form of calcineurin and inhibits calcineurin-mediated signal transduction. The encoded protein is found in the nucleus and contains a leucine zipper domain as well as several PEST motifs, sequences which confer targeted degradation to those proteins which contain them. Alternative splicing results in multiple transcript variants encoding two different isoforms. [provided by RefSeq, Jan 2011]

Research Articles on CABIN1

Similar Products

Product Notes

The CABIN1 cabin1 (Catalog #AAA6146219) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CABIN1 (Calcineurin-binding Protein Cabin-1, Calcineurin Inhibitor, CAIN, KIAA0330) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CABIN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CABIN1 cabin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CABIN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.