SDS-PAGE
Riboflavin-binding protein Recombinant Protein | RTBDN recombinant protein
Recombinant Gallus gallus Riboflavin-binding protein
Gene Names
RBP; Rd; RTBDN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Riboflavin-binding protein; Recombinant Gallus gallus Riboflavin-binding protein; RTBDN recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
18-225aa; Partial
Sequence
QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK
Sequence Length
238
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for RTBDN recombinant protein
Required for the transport of riboflavin to the developing oocyte.
References
Chicken riboflavin-binding protein. cDNA sequence and homology with milk folate-binding protein.Zheng D.B., Lim H.M., Pene J.J., White H.B. IIIJ. Biol. Chem. 263:11126-11129(1988)
Riboflavinuria in the rd chicken. 5'-splice site mutation in the gene for riboflavin-binding protein.MacLachlan I., Nimpf J., White H.B. III, Schneider W.J.J. Biol. Chem. 268:23222-23226(1993)
Characterization of hen egg white- and yolk-riboflavin binding proteins and amino acid sequence of egg white-riboflavin binding protein.Hamazume Y., Mega T., Ikenaka T.J. Biochem. 95:1633-1644(1984)
Comparison of the amino acid sequences of hen plasma-, yolk-, and white-riboflavin binding proteins.Norioka N., Okada T., Hamazume Y., Mega T., Ikenaka T.J. Biochem. 97:19-28(1985)
Positions of disulfide bonds in riboflavin-binding protein of hen egg white.Hamazume Y., Mega T., Ikenaka T.J. Biochem. 101:217-223(1987)
Separation and characterization of the two Asn-linked glycosylation sites of chicken serum riboflavin-binding protein. Glycosylation differences despite similarity of primary structure.Rohrer J.S., White H.B. IIIBiochem. J. 285:275-280(1992)
Phosphorylation sites in riboflavin-binding protein characterized by fast atom bombardment mass spectrometry.Fenselau C., Heller D.N., Miller M.S., White H.B. IIIAnal. Biochem. 150:309-314(1985)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27.8 kDa
NCBI Official Full Name
riboflavin-binding protein
NCBI Official Synonym Full Names
riboflavin binding protein
NCBI Official Symbol
RBP
NCBI Official Synonym Symbols
Rd; RTBDN
NCBI Protein Information
riboflavin-binding protein
UniProt Protein Name
Riboflavin-binding protein
Protein Family
UniProt Gene Name
RBP
UniProt Synonym Gene Names
RBP
UniProt Entry Name
RBP_CHICK
Uniprot Description
Required for the transport of riboflavin to the developing oocyte.
Research Articles on RTBDN
Similar Products
Product Notes
The RTBDN rbp (Catalog #AAA1265444) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-225aa; Partial. The amino acid sequence is listed below: QQYGCLEGDT HKANPSPEPN MHECTLYSES SCCYANFTEQ LAHSPIIKVS NSYWNRCGQL SKSCEDFTKK IECFYRCSPH AARWIDPRYT AAIQSVPLCQ SFCDDWYEAC KDDSICAHNW LTDWERDESG ENHCKSKCVP YSEMYANGTD MCQSMWGESF KVSESSCLCL QMNKKDMVAI KHLLSESSEE SSSMSSSEEH ACQKKLLK. It is sometimes possible for the material contained within the vial of "Riboflavin-binding protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
