Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

C-Myc-binding protein Recombinant Protein | MYCBP recombinant protein

Recombinant Human C-Myc-binding protein

Gene Names
MYCBP; AMY-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-Myc-binding protein; Recombinant Human C-Myc-binding protein; Associate of Myc 1; AMY-1; MYCBP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-103aa; Full Length
Sequence
AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Sequence Length
103
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for MYCBP recombinant protein
May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
Product Categories/Family for MYCBP recombinant protein
References
AMY-1, a novel C-MYC binding protein that stimulates transcription activity of C-MYC.Taira T., Maeda J., Ohishi T., Kitaura H., Yoshida S., Kato H., Ikeda M., Tamai K., Iguchi-Ariga S.M.M., Ariga H.Genes Cells 3:549-565(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.8 kDa
NCBI Official Full Name
C-Myc-binding protein
NCBI Official Synonym Full Names
MYC binding protein
NCBI Official Symbol
MYCBP
NCBI Official Synonym Symbols
AMY-1
NCBI Protein Information
C-Myc-binding protein
UniProt Protein Name
C-Myc-binding protein
Protein Family
UniProt Gene Name
MYCBP
UniProt Synonym Gene Names
AMY1; AMY-1
UniProt Entry Name
MYCBP_HUMAN

NCBI Description

The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

MYCBP: May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC. Belongs to the AMY1 family.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1p33-p32.2

Cellular Component: cytoplasm; mitochondrion; nucleus

Molecular Function: protein binding; transcription coactivator activity

Biological Process: regulation of transcription, DNA-dependent; spermatogenesis; transcription, DNA-dependent

Research Articles on MYCBP

Similar Products

Product Notes

The MYCBP mycbp (Catalog #AAA1285290) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-103aa; Full Length. The amino acid sequence is listed below: AHYKAADSKR EQFRRYLEKS GVLDTLTKVL VALYEEPEKP NSALDFLKHH LGAATPENPE IELLRLELAE MKEKYEAIVE ENKKLKAKLA QYEPPQEEKR AE. It is sometimes possible for the material contained within the vial of "C-Myc-binding protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.