RNA binding motif protein, X-linked-like-1 (RBMXL1) Recombinant Protein | RBMXL1 recombinant protein

Recombinant Human RNA binding motif protein, X-linked-like-1 (RBMXL1)

Cat. Num. AAA1340570

• Gene Names: RBMXL1; RBM1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: RNA binding motif protein; X-linked-like-1 (RBMXL1); Recombinant Human RNA binding motif protein; RBMXL1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-390, Full length protein
• Sequence: MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSRDSYSSSSRGAPRGAGPGGSRSDRGGGRSRY
• Sequence Length: 390

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 242117971
• NCBI GeneID: 494115
• NCBI Accession #: NP_001156008.1
• NCBI GenBank Nucleotide #: NM_001162536.2
• UniProt Accession #: Q96E39
• Molecular Weight: 42,142 Da
• NCBI Official Full Name: RNA binding motif protein, X-linked-like-1
• NCBI Official Synonym Full Names: RNA binding motif protein, X-linked like 1
• NCBI Official Symbol: RBMXL1
• NCBI Official Synonym Symbols: RBM1
• NCBI Protein Information: RNA binding motif protein, X-linked-like-1
• UniProt Protein Name: RNA binding motif protein, X-linked-like-1
• Protein Family: RNA binding motif protein
• UniProt Gene Name: RBMXL1

NCBI Description

This gene represents a retrogene of RNA binding motif protein, X-linked (RBMX), which is located on chromosome X. While all introns in the coding sequence have been processed out compared to the RBMX locus, the ORF is intact and there is specific evidence for transcription at this location. The preservation of the ORF by purifying selection in all Old World monkeys carrying it suggests that this locus is likely to be functional, possibly during male meiosis when X chromosomal genes are silenced or during haploid stages of spermatogenesis. This gene shares 5' exon structure with the cysteine conjugate-beta lyase 2 locus on chromosome 1, but the coding sequences are non-overlapping. Alternative splicing results in two transcript variants. [provided by RefSeq, Jun 2009]

Uniprot Description

RNA-binding protein which may be involved in pre-mRNA splicing.