Putative RNA-binding protein 15 (RBM15) Recombinant Protein | RBM15 recombinant protein

Recombinant Human Putative RNA-binding protein 15 (RBM15) , partial

Cat. Num. AAA1343846

• Gene Names: RBM15; OTT; OTT1; SPEN
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Putative RNA-binding protein 15 (RBM15); Recombinant Human Putative RNA-binding protein 15 (RBM15); partial; RBM15 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 777-956. Partial
• Sequence: VASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGF

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 319996623
• NCBI GeneID: 64783
• NCBI Accession #: NP_001188474.1
• NCBI GenBank Nucleotide #: NM_001201545.1
• UniProt Accession #: Q96T37; Q3ZB86; Q4V760; Q5D058; Q5T613; Q86VW9; Q96PE4; Q96SC5; Q96SC6; Q96SC9; Q96SD0; A1A693
• Molecular Weight: 99,701 Da
• NCBI Official Full Name: putative RNA-binding protein 15 isoform 2
• NCBI Official Synonym Full Names: RNA binding motif protein 15
• NCBI Official Symbol: RBM15
• NCBI Official Synonym Symbols: OTT; OTT1; SPEN
• NCBI Protein Information: putative RNA-binding protein 15
• UniProt Protein Name: Putative RNA-binding protein 15
• Protein Family: Putative RNA-binding protein
• UniProt Gene Name: RBM15
• UniProt Synonym Gene Names: OTT; OTT1

NCBI Description

Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM, Feb 2009]

Uniprot Description

May function as an mRNA export factor, stimulating export and expression of RTE-containing mRNAs which are present in many retrotransposons that require to be exported prior to splicing. High affinity binding of pre-mRNA to RBM15 may allow targeting of the mRNP to the export helicase DBP5 in a manner that is independent of splicing-mediated NXF1 deposition, resulting in export prior to splicing. May be implicated in HOX gene regulation.