Histone-binding protein RBBP4 (Rbbp4) Recombinant Protein | Rbbp4 recombinant protein

Recombinant Mouse Histone-binding protein RBBP4 (Rbbp4)

Cat. Num. AAA1483223

• Gene Names: Rbbp4; RBAP48; mRbAp48
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histone-binding protein RBBP4 (Rbbp4); Recombinant Mouse Histone-binding protein RBBP4 (Rbbp4); Rbbp4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-425, full length protein
• Sequence: ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS
• Sequence Length: 424

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Rbbp4 recombinant protein

This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 47059484
• NCBI GeneID: 19646
• NCBI Accession #: NP_033056.2
• NCBI GenBank Nucleotide #: NM_009030.3
• UniProt Accession #: Q60972; A2A875
• Molecular Weight: 47,656 Da
• NCBI Official Full Name: histone-binding protein RBBP4
• NCBI Official Synonym Full Names: retinoblastoma binding protein 4, chromatin remodeling factor
• NCBI Official Symbol: Rbbp4
• NCBI Official Synonym Symbols: RBAP48; mRbAp48
• NCBI Protein Information: histone-binding protein RBBP4
• UniProt Protein Name: Histone-binding protein RBBP4
• Protein Family: Histone-binding protein
• UniProt Gene Name: Rbbp4
• UniProt Synonym Gene Names: Rbap48; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; RBBP-4

Uniprot Description

Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex ().