LOC103694892 blocking peptide
LOC103694892 Peptide - middle region
Reactivity
Rat
Synonyms
LOC103694892; LOC103694892 Peptide - middle region; LOC103694892 blocking peptide
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VLVTEAASRGPREKFSQSAEDPYSENMNLKILASGRGSSSTFGAFSRSEN
Sequence Length
123
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for LOC103694892 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13 kDa
NCBI Official Full Name
seminal vesicle secretory protein 5
NCBI Official Synonym Full Names
seminal vesicle secretory protein 5
NCBI Official Symbol
Svs5
NCBI Protein Information
seminal vesicle secretory protein 5
UniProt Protein Name
Seminal vesicle secretory protein 5
UniProt Gene Name
Svs5
UniProt Synonym Gene Names
Svp5; SVS V
NCBI Description
androgen-regulated serine-rich structural protein [RGD, Feb 2006]
Similar Products
Product Notes
The LOC103694892 svs5 (Catalog #AAA3248414) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LOC103694892 Peptide - middle region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLVTEAASRG PREKFSQSAE DPYSENMNLK ILASGRGSSS TFGAFSRSEN. It is sometimes possible for the material contained within the vial of "LOC103694892, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
