SDS-Page
(Recombinant Rat PD-L1/B7-H1/CD274 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
PD-L1/B7-H1/CD274 Recombinant Protein | PD-L1 recombinant protein
Recombinant Rat PD-L1/B7-H1/CD274 Protein
Gene Names
Cd274; Pdcd1lg1; RGD1566211
Purity
>95% by SDS-PAGE.
Synonyms
PD-L1/B7-H1/CD274; Recombinant Rat PD-L1/B7-H1/CD274 Protein; B7-H; B7H1; B7-H1; B7H1PDCD1L1; CD274 antigenMGC142294; CD274 molecule; CD274; PDCD1L1; PDCD1LG1; PDL1; PD-L1; PD-L1B7 homolog 1; PDL1PDCD1 ligand 1; programmed celldeath 1 ligand 1; Programmed death ligand 1; PD-L1 recombinant protein
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT
Sequence Length
290
Species
Rat
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Rat PD-L1/B7-H1/CD274 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
SDS-Page
(Recombinant Rat PD-L1/B7-H1/CD274 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for PD-L1 recombinant protein
Description: Recombinant Rat PD-L1/B7-H1/CD274 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ala18-Thr238) of rat PD-L1/B7-H1/CD274 (Accession #D4AE25) fused with a 6xHis tag at the C-terminus.
Background: PD-L1, also known as B7-H1 and CD274, is an approximately 65 kDa transmembrane glycoprotein in the B7family of immune regulatory molecules. PD-L1 is expressed on inflammatory-activated immune cells includingmacrophages, T cells, and B cells, keratinocytes, enothelial and intestinal epithelial cells, as well as a variety ofcarcinomas and melanoma. PD-L1 binds to T cell B7-1/CD80 and PD-1. It suppresses T cell activation andproliferation and induces the apoptosis of activated T cells. It plays a role in the development of immunetolerance by promoting T cell anergy and enhancing regulatory T cell development. PD-L1 favors thedevelopment of anti-inflammatory IL-10 and IL-22 producing dendritic cells and inhibits the development ofTh17 cells. In cancer, PD-L1 provides resistance to T cell mediated lysis, enhances EMT, and enhances thetumorigenic function of Th22 cells.
Background: PD-L1, also known as B7-H1 and CD274, is an approximately 65 kDa transmembrane glycoprotein in the B7family of immune regulatory molecules. PD-L1 is expressed on inflammatory-activated immune cells includingmacrophages, T cells, and B cells, keratinocytes, enothelial and intestinal epithelial cells, as well as a variety ofcarcinomas and melanoma. PD-L1 binds to T cell B7-1/CD80 and PD-1. It suppresses T cell activation andproliferation and induces the apoptosis of activated T cells. It plays a role in the development of immunetolerance by promoting T cell anergy and enhancing regulatory T cell development. PD-L1 favors thedevelopment of anti-inflammatory IL-10 and IL-22 producing dendritic cells and inhibits the development ofTh17 cells. In cancer, PD-L1 provides resistance to T cell mediated lysis, enhances EMT, and enhances thetumorigenic function of Th22 cells.
Product Categories/Family for PD-L1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
programmed cell death 1 ligand 1
NCBI Official Synonym Full Names
CD274 molecule
NCBI Official Symbol
Cd274
NCBI Official Synonym Symbols
Pdcd1lg1; RGD1566211
NCBI Protein Information
programmed cell death 1 ligand 1
UniProt Protein Name
CD274 molecule
UniProt Gene Name
Cd274
Research Articles on PD-L1
Similar Products
Product Notes
The PD-L1 cd274 (Catalog #AAA9140231) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AFTITAPKDL YVVEYGSNVT MECRFPVEQK LDLLALVVYW EKEDKEVIQF VEGEEDLKPQ HSSFRGRAFL PKDQLLKGNA VLQITDVKLQ DAGVYCCMIS YGGADYKRIT LKVNAPYRKI NQRISMDPAT SEHELMCQAE GYPEAEVIWT NSDHQSLSGE TTVTTSQTEE KLLNVTSVLR VNATANDVFH CTFWRVHSGE NHTAELIIPE LPVPRLPHNR T. It is sometimes possible for the material contained within the vial of "PD-L1/B7-H1/CD274, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
