Avil blocking peptide
Avil Peptide - N-terminal region
Reactivity
Rat
Applications
Western Blot
Synonyms
Avil; Avil Peptide - N-terminal region; Avil blocking peptide
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ
Sequence Length
829
Applicable Applications for Avil blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Avil blocking peptide
This is a synthetic peptide designed for use in combination with anti-Avil Antibody, made
Target Description: Avil is a Ca2+-regulated actin-binding protein. It may have a unique function in the morphogenesis of neuronal cells which form ganglia. It is required for SREC1-mediated regulation of neurite-like outgrowth. It plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. It is involved in the formation of long fine actin-containing filopodia-like structures in fibroblast and is required for SREC1-mediated regulation of neurite-like outgrowth. Avil plays a role in ciliogenesis.
Target Description: Avil is a Ca2+-regulated actin-binding protein. It may have a unique function in the morphogenesis of neuronal cells which form ganglia. It is required for SREC1-mediated regulation of neurite-like outgrowth. It plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. It is involved in the formation of long fine actin-containing filopodia-like structures in fibroblast and is required for SREC1-mediated regulation of neurite-like outgrowth. Avil plays a role in ciliogenesis.
Product Categories/Family for Avil blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
advillin
NCBI Official Synonym Full Names
advillin
NCBI Official Symbol
Avil
NCBI Protein Information
advillin
UniProt Protein Name
Advillin
Protein Family
UniProt Gene Name
Avil
UniProt Synonym Gene Names
Advil; Pervin
UniProt Entry Name
AVIL_RAT
Similar Products
Product Notes
The Avil avil (Catalog #AAA3225517) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Avil Peptide - N-terminal region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Avil can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Avil avil for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SGERLXXXXX XKAMLLAKDI RDREGGGRAE IGVIEGDKEA ASPELMTVLQ. It is sometimes possible for the material contained within the vial of "Avil, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
