Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Rabbit AVIL Polyclonal Antibody | anti-AVIL antibody

AVIL antibody - middle region

Gene Names
AVIL; p92; DOC6; ADVIL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AVIL; Polyclonal Antibody; AVIL antibody - middle region; anti-AVIL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF
Sequence Length
819
Applicable Applications for anti-AVIL antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AVIL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-AVIL antibody
This is a rabbit polyclonal antibody against AVIL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
Product Categories/Family for anti-AVIL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
advillin
NCBI Official Synonym Full Names
advillin
NCBI Official Symbol
AVIL
NCBI Official Synonym Symbols
p92; DOC6; ADVIL
NCBI Protein Information
advillin
UniProt Protein Name
Advillin
Protein Family
UniProt Gene Name
AVIL

NCBI Description

The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia. [provided by RefSeq, Jul 2008]

Uniprot Description

Ca2+-regulated actin-binding protein. May have a unique function in the morphogenesis of neuronal cells which form ganglia. Required for SREC1-mediated regulation of neurite-like outgrowth. Plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. Involved in the formation of long fine actin-containing filopodia-like structures in fibroblast. Plays a role in ciliogenesis.

Research Articles on AVIL

Similar Products

Product Notes

The AVIL avil (Catalog #AAA3204296) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AVIL antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AVIL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AVIL avil for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QELPEDVNPA KKENYLSEQD FVSVFGITRG QFAALPGWKQ LQMKKEKGLF. It is sometimes possible for the material contained within the vial of "AVIL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.