Retinoic acid receptor responder protein 2 Recombinant Protein | RARRES2 recombinant protein

Recombinant Human Retinoic acid receptor responder protein 2

Cat. Num. AAA1437672

• Gene Names: RARRES2; TIG2; HP10433
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Retinoic acid receptor responder protein 2; Recombinant Human Retinoic acid receptor responder protein 2; Chemerin; RAR-responsive protein TIG2; Tazarotene-induced gene 2 protein; RARRES2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-157aa; Full Length of Mature Protein
• Sequence: ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
• Sequence Length: 157

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for RARRES2 recombinant protein

Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chokine receptor-like 2 (CCRL2). Positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. Also acts as a proinflammatory adipokine, causing an increase in secretion of proinflammatory and prodiabetic adipokines, which further impair adipose tissue metabolic function and have negative systemic effects including impaired insulin sensitivity, altered glucose and lipid metabolism, and a decrease in vascular function in other tissues. Can have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. Acts as a chotactic factor for leukocyte populations expressing CMKLR1, particularly immature plasmacytoid dendritic cells, but also immature myeloid DCs, macrophages and natural killer cells. Exerts an anti-inflammatory role by preventing TNF/TNFA-induced VCAM1 expression and monocytes adhesion in vascular endothelial cells. The effect is mediated via inhibiting activation of NF-kappa-B and CRK/p38 through stimulation of AKT1/NOS3 signaling and nitric oxide production. Its dual role in inflammation and metabolism might provide a link between chronic inflammation and obesity, as well as obesity-related disorders such as type 2 diabetes and cardiovascular disease. Exhibits an antimicrobial function in the skin

Product Categories/Family for RARRES2 recombinant protein

Neuroscience

References

Tazarotene-induced gene 2 (TIG2)

NCBI and Uniprot Product Information

• NCBI GI #: 4506427
• NCBI GeneID: 5919
• NCBI Accession #: NP_002880.1
• NCBI GenBank Nucleotide #: NM_002889.3
• UniProt Accession #: Q99969; Q7LE02
• Molecular Weight: 31.9 kDa
• NCBI Official Synonym Full Names: retinoic acid receptor responder (tazarotene induced) 2
• NCBI Official Symbol: RARRES2
• NCBI Official Synonym Symbols: TIG2; HP10433
• NCBI Protein Information: retinoic acid receptor responder protein 2
• UniProt Protein Name: Retinoic acid receptor responder protein 2
• Protein Family: Retinoic acid receptor responder protein
• UniProt Gene Name: RARRES2
• UniProt Synonym Gene Names: TIG2
• UniProt Entry Name: RARR2_HUMAN

NCBI Description

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014]

Uniprot Description

RARRES2: Inhibited in psoriatic lesions. Activated by tazarotene in skin rafts and in the epidermis of psoriatic lesions.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: extracellular matrix; extracellular region

Molecular Function: protein binding; receptor binding

Biological Process: cell differentiation; chemotaxis; embryonic gut development; in utero embryonic development; inflammatory response; positive regulation of chemotaxis; positive regulation of fat cell differentiation; positive regulation of protein amino acid phosphorylation; regulation of lipid catabolic process; retinoid metabolic process