Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Receptor activity-modifying protein 1 Recombinant Protein | RAMP1 recombinant protein

Receptor activity-modifying protein 1

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Receptor activity-modifying protein 1; RAMP1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-148aa; full length protein
Sequence
CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for RAMP1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for RAMP1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,988 Da
NCBI Official Full Name
receptor activity-modifying protein 1 isoform 1
NCBI Official Synonym Full Names
receptor activity modifying protein 1
NCBI Official Symbol
RAMP1
NCBI Protein Information
receptor activity-modifying protein 1
UniProt Protein Name
Receptor activity-modifying protein 1
UniProt Gene Name
RAMP1
UniProt Synonym Gene Names
CRLR activity-modifying protein 1
UniProt Entry Name
RAMP1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

RAMP1: Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL. Belongs to the RAMP family.

Protein type: Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q36-q37.1

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: calcitonin receptor activity; calcitonin receptor binding; protein binding; protein transporter activity; receptor activity

Biological Process: angiogenesis; calcium ion transport; positive regulation of cAMP biosynthetic process; positive regulation of protein amino acid glycosylation; protein transport; receptor internalization; regulation of G-protein coupled receptor protein signaling pathway

Research Articles on RAMP1

Similar Products

Product Notes

The RAMP1 ramp1 (Catalog #AAA7043244) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-148aa; full length protein. The amino acid sequence is listed below: CQEANYGALL RELCLTQFQV DMEAVGETLW CDWGRTIRSY RELADCTWHM AEKLGCFWPN AEVDRFFLAV HGRYFRSCPI SGRAVRDPPG SILYPFIVVP ITVTLLVTAL VVWQSKRTEG IV. It is sometimes possible for the material contained within the vial of "Receptor activity-modifying protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.