Cell cycle checkpoint control protein RAD9A (Rad9a) Recombinant Protein | Rad9a recombinant protein

Recombinant Mouse Cell cycle checkpoint control protein RAD9A (Rad9a)

Cat. Num. AAA1396215

• Gene Names: Rad9a; Rad9
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cell cycle checkpoint control protein RAD9A (Rad9a); Recombinant Mouse Cell cycle checkpoint control protein RAD9A (Rad9a); Rad9a recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-389, full length protein
• Sequence: MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQYQAASPGQDLLRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKKTHNLSFQDCESLQAVFDPASCPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRSYQEEEADSTSKAMVTETSIGDEDFQQLHAPEGIAVTFCLKEFRGLLSFAESANLPLTIHFDVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKPHQPVPQKQAHSTPHLDDFTSDDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTVPGTPPPKKFRSLFFGSILAPVHSPQGPNPVLAEDSDGEG
• Sequence Length: 389

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Rad9a recombinant protein

This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein is found to possess 3 to 5 exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. It forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. Use of alternative polyA sites has been noted for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 6755282
• NCBI GeneID: 19367
• NCBI Accession #: NP_035367.1
• NCBI GenBank Nucleotide #: NM_011237.2
• UniProt Accession #: Q9Z0F6; Q8QZZ3
• Molecular Weight: 42,059 Da
• NCBI Official Full Name: cell cycle checkpoint control protein RAD9A
• NCBI Official Synonym Full Names: RAD9 checkpoint clamp component A
• NCBI Official Symbol: Rad9a
• NCBI Official Synonym Symbols: Rad9
• NCBI Protein Information: cell cycle checkpoint control protein RAD9A
• UniProt Protein Name: Cell cycle checkpoint control protein RAD9A
• Protein Family: Cell cycle checkpoint control protein
• UniProt Gene Name: Rad9a
• UniProt Synonym Gene Names: Rad9; mRAD9

Uniprot Description

Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase. RAD9A possesses 3'->5' double stranded DNA exonuclease activity ().