Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western blot (Western blot analysis STC1 using MCF7 whole cell lysates)

Rabbit anti-Human STC1 Antibody | anti-STC1 antibody

STC1 Antibody

Gene Names
STC1; STC
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified
Synonyms
STC1; STC1 Antibody; Stanniocalcin; Stanniocalcin-1; STC; STC-1; Stc1; STC1_HUMAN; anti-STC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Isotype
Rabbit IgG
Specificity
STC1 Antibody detects endogenous levels of total STC1
Purity/Purification
Immunogen affinity purified
Concentration
1.0mg/ml (varies by lot)
Sequence
MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVV RCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFD TQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEEC YSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECD EDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRR RTNEPQKLKVLLRNLRGEEDSPSHIK RTSHESA
Sequence Length
247
Applicable Applications for anti-STC1 antibody
Western Blot (WB)
Application Notes
WB: 1:1000-3000
Optimal dilutions/concentrations should be determined by the end user.
Immunogen
A synthesized peptide derived from human STC1
Function
Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia.
Subcellular Location
Secreted.
Tissue Specificity
Expressed in most tissues, with the highest levels in ovary, prostate, heart, kidney and thyroid. In the kidney, expression is confined to the nephron, specifically in the distal convoluted tubule and in the collecting tubule. Not detected in the brain, liver, spleen, peripheral blood leukocytes and adrenal medulla.
Buffer
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol
Subunit Structure
Homodimer; disulfide-linked.
Similarity
Belongs to the stanniocalcin family.
Preparation and Storage
Store at -20 °C. Stable for 12 months from date of receipt

Western blot

(Western blot analysis STC1 using MCF7 whole cell lysates)

Western blot (Western blot analysis STC1 using MCF7 whole cell lysates)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
stanniocalcin-1
NCBI Official Synonym Full Names
stanniocalcin 1
NCBI Official Symbol
STC1
NCBI Official Synonym Symbols
STC
NCBI Protein Information
stanniocalcin-1
UniProt Protein Name
Stanniocalcin-1
Protein Family
UniProt Gene Name
STC1
UniProt Synonym Gene Names
STC; STC-1

NCBI Description

This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. [provided by RefSeq, Jul 2008]

Uniprot Description

STC1: Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia. Belongs to the stanniocalcin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8p21.2

Cellular Component: cytoplasm; nucleus

Biological Process: cellular calcium ion homeostasis; endothelial cell morphogenesis; negative regulation of calcium ion transport; negative regulation of cell migration

Research Articles on STC1

Similar Products

Product Notes

The STC1 stc1 (Catalog #AAA9387697) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STC1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000-3000 Optimal dilutions/concentrations should be determined by the end user. Researchers should empirically determine the suitability of the STC1 stc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLQNSAVLLV LVISASATHE AEQNDSVSPR KSRVAAQNSA EVV RCLNS ALQVGCGAFA CLENSTCDTD GMYDICKSFL YSAAKFD T QGKAFVKESL KCIANGVTSK VFLAIRRCST FQRMIAEVQE EC YSKLNV CSIAKRNPEA ITEVVQLPNH FSNRYYNRLV RSLLECD E DTVSTIRDSL MEKIGPNMAS LFHILQTDHC AQTHPRADFN RR RTNEPQ KLKVLLRNLR GEEDSPSHIK RTSHESA . It is sometimes possible for the material contained within the vial of "STC1, Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.