Ras-related protein Rab-1A (RAB1A) Recombinant Protein | RAB1A recombinant protein

Recombinant Dog Ras-related protein Rab-1A (RAB1A)

Cat. Num. AAA968393

• Gene Names: RAB1A; RAB1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-related protein Rab-1A (RAB1A); Recombinant Dog Ras-related protein Rab-1A (RAB1A); RAB1A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-205, Full length protein
• Sequence: SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
• Sequence Length: 204

• Species: Canis familiaris (Dog) (Canis lupus familiaris)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for RAB1A recombinant protein

This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms.

NCBI and Uniprot Product Information

• NCBI GI #: 55741705
• NCBI GeneID: 403774
• NCBI Accession #: NP_001003153.1
• NCBI GenBank Nucleotide #: NM_001003153.1
• UniProt Accession #: P62822; P05711
• Molecular Weight: 22,678 Da
• NCBI Official Full Name: ras-related protein Rab-1A
• NCBI Official Synonym Full Names: RAB1A, member RAS oncogene family
• NCBI Official Symbol: RAB1A
• NCBI Official Synonym Symbols: RAB1
• NCBI Protein Information: ras-related protein Rab-1A
• UniProt Protein Name: Ras-related protein Rab-1A
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB1A
• UniProt Synonym Gene Names: RAB1

Uniprot Description

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport.