Orotate phosphoribosyltransferase Recombinant Protein | pyrE recombinant protein
Recombinant Laribacter hongkongensis (strain HLHK9) Orotate phosphoribosyltransferase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Orotate phosphoribosyltransferase; Recombinant Laribacter hongkongensis (strain HLHK9) Orotate phosphoribosyltransferase; OPRT; OPRTase; pyrE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-213. Full Length
Sequence
MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR
Species
Laribacter hongkongensis (strain HLHK9)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
Related Product Information for pyrE recombinant protein
Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).
References
"The complete genome and proteome of Laribacter hongkongensis reveal potential mechanisms for adaptations to different temperatures and habitats."
Woo P.C.Y., Lau S.K.P., Tse H., Teng J.L.L., Curreem S.O., Tsang A.K.L., Fan R.Y.Y., Wong G.K.M., Huang Y., Loman N.J., Snyder L.A.S., Cai J.J., Huang J.-D., Mak W., Pallen M.J., Lok S., Yuen K.-Y.
PLoS Genet. 5:E1000416-E1000416(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.9 kDa
NCBI Official Full Name
orotate phosphoribosyltransferase
UniProt Protein Name
Orotate phosphoribosyltransferase
Protein Family
UniProt Gene Name
pyrE
UniProt Synonym Gene Names
OPRT; OPRTase
UniProt Entry Name
PYRE_LARHH
Uniprot Description
Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).
