Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human Fetal heartAGTR2 antibody - N-terminal region validated by WB using Fetal Heart at 0.2-1 ug/ml.)

Rabbit AGTR2 Polyclonal Antibody | anti-AGTR2 antibody

AGTR2 antibody - N-terminal region

Gene Names
AGTR2; AT2; ATGR2; MRX88
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AGTR2; Polyclonal Antibody; AGTR2 antibody - N-terminal region; anti-AGTR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT
Sequence Length
363
Applicable Applications for anti-AGTR2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AGTR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human Fetal heartAGTR2 antibody - N-terminal region validated by WB using Fetal Heart at 0.2-1 ug/ml.)

Western Blot (WB) (Sample Type: Human Fetal heartAGTR2 antibody - N-terminal region validated by WB using Fetal Heart at 0.2-1 ug/ml.)

Western Blot (WB)

(Sample Type: Mouse brain membranesAGTR2 antibody - N-terminal region validated by WB using Mouse brain membranes at 1:4,000.)

Western Blot (WB) (Sample Type: Mouse brain membranesAGTR2 antibody - N-terminal region validated by WB using Mouse brain membranes at 1:4,000.)
Related Product Information for anti-AGTR2 antibody
This is a rabbit polyclonal antibody against AGTR2. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
186
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
type-2 angiotensin II receptor
NCBI Official Synonym Full Names
angiotensin II receptor type 2
NCBI Official Symbol
AGTR2
NCBI Official Synonym Symbols
AT2; ATGR2; MRX88
NCBI Protein Information
type-2 angiotensin II receptor
UniProt Protein Name
Type-2 angiotensin II receptor
UniProt Gene Name
AGTR2
UniProt Synonym Gene Names
AT2
UniProt Entry Name
AGTR2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked cognitive disability. [provided by RefSeq, Jan 2010]

Uniprot Description

AT2: Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation. Defects in AGTR2 are the cause of mental retardation X- linked type 88 (MRX88). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: Xq22-q23

Cellular Component: integral to plasma membrane; perinuclear region of cytoplasm; extracellular region; plasma membrane

Molecular Function: protein binding; receptor antagonist activity; angiotensin type II receptor activity; peptide hormone binding; transcription factor binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; negative regulation of icosanoid secretion; regulation of transcription factor import into nucleus; positive regulation of nitric oxide biosynthetic process; negative regulation of heart rate; negative regulation of nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; renin-angiotensin regulation of aldosterone production; dopamine biosynthetic process; positive regulation of vasodilation; angiotensin mediated vasodilation involved in regulation of systemic arterial blood pressure; cerebellar cortex development; cell surface receptor linked signal transduction; regulation of systemic arterial blood pressure by circulatory renin-angiotensin; regulation of blood pressure; positive regulation of cell proliferation; inflammatory response; cellular sodium ion homeostasis; positive regulation of nitric-oxide synthase activity; negative regulation of blood vessel endothelial cell migration; response to organic nitrogen; brain renin-angiotensin system; G-protein coupled receptor protein signaling pathway; negative regulation of fibroblast proliferation; G-protein signaling, coupled to cGMP nucleotide second messenger; blood vessel remodeling; brain development; negative regulation of cell growth; nitric oxide mediated signal transduction; positive regulation of cytokine secretion

Research Articles on AGTR2

Similar Products

Product Notes

The AGTR2 agtr2 (Catalog #AAA3214602) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGTR2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AGTR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGTR2 agtr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LHFGLVNISG NNESTLNCSQ KPSDKHLDAI PILYYIIFVI GFLVNIVVVT. It is sometimes possible for the material contained within the vial of "AGTR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.