Putative assembly protein ORF301 Recombinant Protein | Pf3_6 recombinant protein
Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF301
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative assembly protein ORF301; Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF301; Pf3_6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-301
Sequence
MITLITAVPGSGKTLYAIGLIEAALSEGRPVFTNISGLVKDKFSNPHLLSDAPDDWRDTPEGSLVVYDEAQQAHLYPSNAQRGPVTDERLTAMETHRHTGHDLVFITQAPTFVHHHIRKLVGLHIHLYRSRGLQAASKYEWSHVCDSPNDRKEQQRADFVLWKFPKEHFAFYTSAVMHTHKFKMPKKIGVLLVFVVLGLGAVGFNLYKNSGLASMAEATASVAEATPSPLALNGVKPSSLAAPYQWSAAAPAVPVSGCVANRSTNRCQCFDASGVVLAIEHAACLSVISSPLPRQLLSTSK
Sequence Length
301
Species
Pseudomonas phage Pf3 (Bacteriophage Pf3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,731 Da
NCBI Official Full Name
hypothetical protein Pf3_6
NCBI Official Symbol
Pf3_6
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Putative assembly protein ORF301
Protein Family
UniProt Entry Name
VG301_BPPF3
Uniprot Description
Function: May play a role in phage assembly.
Subcellular location: Host membrane; Single-pass membrane protein
Potential.
Miscellaneous: The strain Nijmegen sequence is shown.
Similar Products
Product Notes
The Pf3_6 (Catalog #AAA1033947) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-301. The amino acid sequence is listed below: MITLITAVPG SGKTLYAIGL IEAALSEGRP VFTNISGLVK DKFSNPHLLS DAPDDWRDTP EGSLVVYDEA QQAHLYPSNA QRGPVTDERL TAMETHRHTG HDLVFITQAP TFVHHHIRKL VGLHIHLYRS RGLQAASKYE WSHVCDSPND RKEQQRADFV LWKFPKEHFA FYTSAVMHTH KFKMPKKIGV LLVFVVLGLG AVGFNLYKNS GLASMAEATA SVAEATPSPL ALNGVKPSSL AAPYQWSAAA PAVPVSGCVA NRSTNRCQCF DASGVVLAIE HAACLSVISS PLPRQLLSTS K. It is sometimes possible for the material contained within the vial of "Putative assembly protein ORF301, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
