Receptor-Type Tyrosine-Protein Phosphatase zeta (PTPRZ1) Recombinant Protein | PTPRZ1 recombinant protein

Recombinant Human Receptor-Type Tyrosine-Protein Phosphatase zeta (PTPRZ1), Partial

Cat. Num. AAA7115248

• Gene Names: PTPRZ1; PTPZ; HPTPZ; PTP18; PTPRZ; RPTPB; HPTPzeta; PTP-ZETA; RPTPbeta; phosphacan; R-PTP-zeta-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Receptor-Type Tyrosine-Protein Phosphatase zeta (PTPRZ1); Recombinant Human Receptor-Type Tyrosine-Protein Phosphatase zeta (PTPRZ1); Partial; Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; R-PTP-zeta-2; HTPZP2; PTPRZ; PTPRZ2; PTPZ; PTPRZ1 recombinant protein

• Host: E Coli
• Specificity: Specifically expressed in the central nervous system, where it is localized in the Purkinje cell layer of the cerebellum, the dentate gyrus, and the subependymal layer of the anterior horn of the lateral ventricle. Developmentally regulated in the brain.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 36-300aa; partial
• Sequence: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
• Sequence Length: 1455

• Species: Human
• Tag: N-terminal 6xHis-tagged
• Subcellular Location: Isoform 1: Cell membrane, Single-Pass Type I Membrane Protein, Secreted
• Protein Families: Protein-tyrosine phosphatase family, Receptor class 5 subfamily
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

Related Product Information for PTPRZ1 recombinant protein

Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades (By similarity).

Product Categories/Family for PTPRZ1 recombinant protein

Neuroscience

References

"A human transmembrane protein-tyrosine-phosphatase, PTP zeta, is expressed in brain and has an N-terminal receptor domain homologous to carbonic anhydrases." Krueger N.X., Saito H. Proc. Natl. Acad. Sci. U.S.A. 89:7417-7421(1992).

NCBI and Uniprot Product Information

• NCBI GI #: 332205943
• NCBI GeneID: 5803
• NCBI Accession #: NP_001193767.1
• NCBI GenBank Nucleotide #: NM_001206838.1
• UniProt Accession #: P23471
• Molecular Weight: 34.1 kDa
• NCBI Official Full Name: receptor-type tyrosine-protein phosphatase zeta isoform 2
• NCBI Official Synonym Full Names: protein tyrosine phosphatase receptor type Z1
• NCBI Official Symbol: PTPRZ1
• NCBI Official Synonym Symbols: PTPZ; HPTPZ; PTP18; PTPRZ; RPTPB; HPTPzeta; PTP-ZETA; RPTPbeta; phosphacan; R-PTP-zeta-2
• NCBI Protein Information: receptor-type tyrosine-protein phosphatase zeta
• UniProt Protein Name: Receptor-type tyrosine-protein phosphatase zeta
• Protein Family: Receptor-type tyrosine-protein phosphatase
• UniProt Gene Name: PTPRZ1
• UniProt Synonym Gene Names: HTPZP2; PTPRZ; PTPRZ2; PTPZ; R-PTP-zeta
• UniProt Entry Name: PTPRZ_HUMAN

NCBI Description

This gene encodes a member of the receptor protein tyrosine phosphatase family. Expression of this gene is restricted to the central nervous system (CNS), and it may be involved in the regulation of specific developmental processes in the CNS. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, May 2011]

Uniprot Description

PTPRZ1: May be involved in the regulation of specific developmental processes in the CNS. Belongs to the protein-tyrosine phosphatase family. Receptor class 5 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Receptor protein phosphatase, tyrosine; EC 3.1.3.48

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: proteinaceous extracellular matrix; integral to plasma membrane

Molecular Function: protein binding; transmembrane receptor protein tyrosine phosphatase activity; protein tyrosine phosphatase activity

Biological Process: learning and/or memory; central nervous system development; axonogenesis; oligodendrocyte differentiation; hemopoietic progenitor cell differentiation; protein amino acid dephosphorylation

Disease: Helicobacter Pylori Infection, Susceptibility To