Mouse AAAS Monoclonal Antibody | anti-AAAS antibody

AAAS (Aladin, Adracalin, ADRACALA, GL003) (FITC)

Cat. Num. AAA6145708

• Gene Names: AAAS; AAA; AAASb; GL003; ALADIN; ADRACALA; ADRACALIN
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AAAS; Monoclonal Antibody; AAAS (Aladin; Adracalin; ADRACALA; GL003) (FITC); anti-AAAS antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5A1
• Specificity: Recognizes human AAAS. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-AAAS antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from AAAS (NP_056480) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(AAAS monoclonal antibody Western Blot analysis of AAAS expression in HeLa.)

Western Blot (WB)

(AAAS monoclonal antibody. Western Blot analysis of AAAS expression in PC-12.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged AAAS is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-AAAS antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12962937
• NCBI GeneID: 8086
• NCBI Accession #: NP_056480
• NCBI GenBank Nucleotide #: NM_015665
• UniProt Accession #: Q9NRG9
• Molecular Weight: 60kDa
• NCBI Official Full Name: aladin isoform 1
• NCBI Official Synonym Full Names: aladin WD repeat nucleoporin
• NCBI Official Symbol: AAAS
• NCBI Official Synonym Symbols: AAA; AAASb; GL003; ALADIN; ADRACALA; ADRACALIN
• NCBI Protein Information: aladin
• UniProt Protein Name: Aladin
• Protein Family: Aladin
• UniProt Gene Name: AAAS
• UniProt Synonym Gene Names: ADRACALA
• UniProt Entry Name: AAAS_HUMAN

NCBI Description

The protein encoded by this gene is a member of the WD-repeat family of regulatory proteins and may be involved in normal development of the peripheral and central nervous system. The encoded protein is part of the nuclear pore complex and is anchored there by NDC1. Defects in this gene are a cause of achalasia-addisonianism-alacrima syndrome (AAAS), also called triple-A syndrome or Allgrove syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

AAAS: Plays a role in the normal development of the peripheral and central nervous system. Defects in AAAS are the cause of achalasia-addisonianism- alacrima syndrome (AAAS); also known as triple-A syndrome or Allgrove syndrome. AAAS is an autosomal recessive disorder characterized by adreno-corticotropic hormone (ACTH)- resistant adrenal failure, achalasia of the esophageal cardia and alacrima. The syndrome is associated with variable and progressive neurological impairment involving the central, peripheral, and autonomic nervous system. Other features such as palmoplantar hyperkeratosis, short stature, facial dysmorphy and osteoporosis may also be present. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Nuclear envelope

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; centrosome; nuclear membrane; membrane; cytoplasm; nuclear pore; nuclear envelope; nucleus

Biological Process: mRNA transport; viral reproduction; cytokine and chemokine mediated signaling pathway; mitotic nuclear envelope disassembly; pathogenesis; nucleocytoplasmic transport; learning; viral infectious cycle; glucose transport; protein transport; fertilization; hexose transport; regulation of nucleocytoplasmic transport; carbohydrate metabolic process; gene expression; viral transcription; mitotic cell cycle; transmembrane transport

Disease: Achalasia-addisonianism-alacrima Syndrome