Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) Recombinant Protein | PTH1R recombinant protein
Recombinant Pig Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R)
Gene Names
PTH1R; PTH; PTHR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R); Recombinant Pig Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R); PTH1R recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-585aa; Full length protein
Sequence
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGK LYPESGEDTGSRHQGRPCLPEWDHILCWPLGAPGEVVAMPCPDYIYDFNHKGHAYRRCDR NGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILA YFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPLP PVAATSYVGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGL PAIFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRE TNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQ GFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPR TGLGLPLSPRLLPAATTNGHPQLPCHTKPETPALQTTPPVVAAPKDDGFLNGSCSGLDEE ASAPERPSVLLQEEWETVM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pig
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PTH1R recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,682 Da
NCBI Official Full Name
parathyroid hormone/parathyroid hormone-related peptide receptor
NCBI Official Symbol
PTH1R
NCBI Official Synonym Symbols
PTH; PTHR1
NCBI Protein Information
parathyroid hormone/parathyroid hormone-related peptide receptor
UniProt Protein Name
Parathyroid hormone/parathyroid hormone-related peptide receptor
UniProt Gene Name
PTH1R
UniProt Synonym Gene Names
PTHR; PTHR1; PTH/PTHr receptor; PTH1 receptor
UniProt Entry Name
PTH1R_PIG
Uniprot Description
Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Research Articles on PTH1R
Similar Products
Product Notes
The PTH1R pth1r (Catalog #AAA7028232) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-585aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PTH1R pth1r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DADDVMTKEE QIFLLHRAQA QCEKRLKEVL QRPADIMESD KGWASAPTSG KPRKEKASGK LYPESGEDTG SRHQGRPCLP EWDHILCWPL GAPGEVVAMP CPDYIYDFNH KGHAYRRCDR NGSWELVPGH NRTWANYSEC VKFLTNETRE REVFDRLGMI YTVGYSVSLA SLTVAVLILA YFRRLHCTRN YIHMHLFLSF MLRAVSIFVK DAVLYSGATL DEAERLTEEE LRAIAQAPLP PVAATSYVGC RVAVTFFLYF LATNYYWILV EGLYLHSLIF MAFFSEKKYL WGFTVFGWGL PAIFVAVWVS VRATLANTGC WDLSSGNKKW IIQVPILASI VLNFILFINI VRVLATKLRE TNAGRCDTRQ QYRKLLKSTL VLMPLFGVHY IVFMATPYTE VSGTLWQVQM HYEMLFNSFQ GFFVAIIYCF CNGEVQAEIK KSWSRWTLAL DFKRKARSGS SSYSYGPMVS HTSVTNVGPR TGLGLPLSPR LLPAATTNGH PQLPCHTKPE TPALQTTPPV VAAPKDDGFL NGSCSGLDEE ASAPERPSVL LQEEWETVM. It is sometimes possible for the material contained within the vial of "Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
