Proteasome subunit alpha type-1 (Psma1) Recombinant Protein | Psma1 recombinant protein

Recombinant Mouse Proteasome subunit alpha type-1 (Psma1)

Cat. Num. AAA1470193

• Gene Names: Psma1; C2; HC2; Pros-30; alpha-type
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proteasome subunit alpha type-1 (Psma1); Recombinant Mouse Proteasome subunit alpha type-1 (Psma1); Psma1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-263, full length protein
• Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERPQRKAQPSQAAEEPAEKADEPMEH
• Sequence Length: 263

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 33563282
• NCBI GeneID: 26440
• NCBI Accession #: NP_036095.1
• NCBI GenBank Nucleotide #: NM_011965.2
• UniProt Accession #: Q9R1P4
• Molecular Weight: 29,547 Da
• NCBI Official Full Name: proteasome subunit alpha type-1
• NCBI Official Synonym Full Names: proteasome (prosome, macropain) subunit, alpha type 1
• NCBI Official Symbol: Psma1
• NCBI Official Synonym Symbols: C2; HC2; Pros-30; alpha-type
• NCBI Protein Information: proteasome subunit alpha type-1
• UniProt Protein Name: Proteasome subunit alpha type-1
• Protein Family: Proteasome
• UniProt Gene Name: Psma1

Uniprot Description

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).