Putative trypsin-6 (TRY6) Recombinant Protein | TRY6 recombinant protein
Recombinant Human Putative trypsin-6 (TRY6)
Gene Names
PRSS3P2; T6; TRY6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative trypsin-6 (TRY6); Recombinant Human Putative trypsin-6 (TRY6); TRY6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-247, Full length protein
Sequence
VPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKPHIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNRITLNNDIMLIKLSTPAVINAHVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLKITSKMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKRRPGVYTKVYNYVDWIKDTIAANS
Sequence Length
232
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26,537 Da
NCBI Official Full Name
Putative trypsin-6
NCBI Official Synonym Full Names
PRSS3 pseudogene 2
NCBI Official Symbol
PRSS3P2
NCBI Official Synonym Symbols
T6; TRY6
UniProt Protein Name
Putative trypsin-6
Protein Family
UniProt Gene Name
PRSS3P2
UniProt Synonym Gene Names
T6; TRY6
NCBI Description
Although this locus appears to encode a protein similar to trypsinogen, the locus is thought to be a transcribed pseudogene. ESTs support its transcription, but expression of its predicted protein has not been observed. Its predicted protein sequence differs significantly from the known functional trypsinogens, including a different amino acid at the conserved residue 122 which is important for autolysis. This pseudogene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq, Jul 2008]
Uniprot Description
May regulate cell migration.
Research Articles on TRY6
Similar Products
Product Notes
The TRY6 prss3p2 (Catalog #AAA1365161) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-247, Full length protein. The amino acid sequence is listed below: VPFDDDDKIV GGYTCEENSV PYQVSLNSGS HFCGGSLISE QWVVSAGHCY KPHIQVRLGE HNIEVLEGNE QFINAAKIIR HPKYNRITLN NDIMLIKLST PAVINAHVST ISLPTAPPAA GTECLISGWG NTLSSGADYP DELQCLDAPV LTQAKCKASY PLKITSKMFC VGFLEGGKDS CQGDSGGPVV CNGQLQGIVS WGYGCAQKRR PGVYTKVYNY VDWIKDTIAA NS. It is sometimes possible for the material contained within the vial of "Putative trypsin-6 (TRY6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
