Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Cluster Of Differentiation 3d (CD3d) Recombinant Protein | CD3d recombinant protein

Recombinant Cluster Of Differentiation 3d (CD3d)

Gene Names
CD3D; T3D; CD3-DELTA
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Cluster Of Differentiation 3d (CD3d); Recombinant Cluster Of Differentiation 3d (CD3d); CD3d recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-QVS PFKIPIEELE DRVFVNCNTS ITWVEGTVGT LLSDITRLDL GKRILDPRGI YRCNGTDIYK DKESTVQVHY RMCQSCVELD PATVAGIIVT DVI
Sequence Length
171
Applicable Applications for CD3d recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Homo sapiens (Human)
Expression System
Prokaryotic expression
Residues
Gln18~Ile113 (Accession # P04234) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
915
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.5kDa
NCBI Official Full Name
T-cell surface glycoprotein CD3 delta chain isoform A
NCBI Official Synonym Full Names
CD3d molecule, delta (CD3-TCR complex)
NCBI Official Symbol
CD3D
NCBI Official Synonym Symbols
T3D; CD3-DELTA
NCBI Protein Information
T-cell surface glycoprotein CD3 delta chain; OKT3, delta chain; CD3 antigen, delta subunit; T-cell receptor T3 delta chain; CD3d antigen, delta polypeptide (TiT3 complex)
UniProt Protein Name
T-cell surface glycoprotein CD3 delta chain
UniProt Gene Name
CD3D
UniProt Synonym Gene Names
T3D
UniProt Entry Name
CD3D_HUMAN

NCBI Description

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq, Feb 2009]

Uniprot Description

CD3D: a T cell surface glycoprotein that is a component of the T cell antigen receptor. A defect in this protein causes a severe combined immunodeficiency characterized by the absence of T cells but normal B cells. Contains 1 ITAM domain.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: T cell receptor complex; cytoplasm; plasma membrane; integral to membrane; alpha-beta T cell receptor complex

Molecular Function: transmembrane receptor activity; protein heterodimerization activity; transcription coactivator activity

Biological Process: regulation of immune response; cell surface receptor linked signal transduction; T cell costimulation; positive regulation of transcription from RNA polymerase II promoter; T cell receptor signaling pathway; positive thymic T cell selection; T cell differentiation

Disease: Immunodeficiency 19

Research Articles on CD3d

Similar Products

Product Notes

The CD3d cd3d (Catalog #AAA2009024) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cluster Of Differentiation 3d (CD3d) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the CD3d cd3d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-QVS PFKIPIEELE DRVFVNCNTS ITWVEGTVGT LLSDITRLDL GKRILDPRGI YRCNGTDIYK DKESTVQVHY RMCQSCVELD PATVAGIIVT DVI. It is sometimes possible for the material contained within the vial of "Cluster Of Differentiation 3d (CD3d), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.