Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Testisin (PRSS21) Recombinant Protein | PRSS21 recombinant protein

Recombinant Human Testisin (PRSS21)

Gene Names
PRSS21; ESP1; ESP-1; TEST1; TESTISIN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Testisin (PRSS21); Recombinant Human Testisin (PRSS21); Testisin; EC=3.4.21.-; Eosinophil serine protease 1; ESP-1; Serine protease 21; PRSS21 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
42-288aa; Full-Length of the Mature Protein
Sequence
IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS
Sequence Length
288
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for PRSS21 recombinant protein
Could regulate proteolytic events associated with testicular germ cell maturation.
Product Categories/Family for PRSS21 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.8 kDa
NCBI Official Full Name
testisin isoform 4 preproprotein
NCBI Official Synonym Full Names
protease, serine, 21 (testisin)
NCBI Official Symbol
PRSS21
NCBI Official Synonym Symbols
ESP1; ESP-1; TEST1; TESTISIN
NCBI Protein Information
testisin; eosinophil serine protease 1; serine protease from eosinophils
UniProt Protein Name
Testisin
Protein Family
UniProt Gene Name
PRSS21
UniProt Synonym Gene Names
ESP1; TEST1; ESP-1
UniProt Entry Name
TEST_HUMAN

NCBI Description

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. The encoded protein is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The encoded protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and may be involved in progression of testicular tumors of germ cell origin. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

PRSS21: Could regulate proteolytic events associated with testicular germ cell maturation. Belongs to the peptidase S1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.21.-; Protease; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: spermatogenesis; proteolysis

Research Articles on PRSS21

Similar Products

Product Notes

The PRSS21 prss21 (Catalog #AAA1306838) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 42-288aa; Full-Length of the Mature Protein. The amino acid sequence is listed below: IVGGEDAELG RWPWQGSLRL WDSHVCGVSL LSHRWALTAA HCFETYSDLS DPSGWMVQFG QLTSMPSFWS LQAYYTRYFV SNIYLSPRYL GNSPYDIALV KLSAPVTYTK HIQPICLQAS TFEFENRTDC WVTGWGYIKE DEALPSPHTL QEVQVAIINN SMCNHLFLKY SFRKDIFGDM VCAGNAQGGK DACFGDSGGP LACNKNGLWY QIGVVSWGVG CGRPNRPGVY TNISHHFEWI QKLMAQS. It is sometimes possible for the material contained within the vial of "Testisin (PRSS21), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.