Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KLK3 expression in transfected 293T cell line by KLK3 polyclonal antibody. Lane 1: KLK3 transfected lysate (28.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human KLK3 Polyclonal Antibody | anti-KLK3 antibody

KLK3 (APS, Prostate-specific Antigen, PSA, Gamma-seminoprotein, Seminin, Kallikrein-3, P-30 Antigen, Semenogelase) (Biotin)

Gene Names
KLK3; APS; PSA; hK3; KLK2A1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLK3; Polyclonal Antibody; KLK3 (APS; Prostate-specific Antigen; PSA; Gamma-seminoprotein; Seminin; Kallikrein-3; P-30 Antigen; Semenogelase) (Biotin); anti-KLK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KLK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-KLK3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human KLK3, aa1-261 (NP_001639.1).
Immunogen Sequence
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KLK3 expression in transfected 293T cell line by KLK3 polyclonal antibody. Lane 1: KLK3 transfected lysate (28.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KLK3 expression in transfected 293T cell line by KLK3 polyclonal antibody. Lane 1: KLK3 transfected lysate (28.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between KLK3 and A2M. HeLa cells were stained with KLK3 rabbit purified polyclonal 1:1200 and A2M mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between KLK3 and A2M. HeLa cells were stained with KLK3 rabbit purified polyclonal 1:1200 and A2M mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)
Related Product Information for anti-KLK3 antibody
Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. KLK 3 (also known as prostate specific antigen) is a marker for prostatic cancer and is involved in the pathogenesis and/or progression of prostate, breast, and possibly other malignancies.
Product Categories/Family for anti-KLK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
354
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,741 Da
NCBI Official Full Name
prostate-specific antigen isoform 1 preproprotein
NCBI Official Synonym Full Names
kallikrein-related peptidase 3
NCBI Official Symbol
KLK3
NCBI Official Synonym Symbols
APS; PSA; hK3; KLK2A1
NCBI Protein Information
prostate-specific antigen; seminin; P-30 antigen; kallikrein-3; semenogelase; gamma-seminoprotein; prostate specific antigen
UniProt Protein Name
Prostate-specific antigen
Protein Family
UniProt Gene Name
KLK3
UniProt Synonym Gene Names
APS; PSA; Seminin
UniProt Entry Name
KLK3_HUMAN

NCBI Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

PSA: Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum. Forms heterodimer with SERPINA5. Inhibited by SERPINA5. Activity is strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders. Belongs to the peptidase S1 family. Kallikrein subfamily.

Protein type: Secreted; Protease; EC 3.4.21.77; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.41

Cellular Component: extracellular region; nucleus

Molecular Function: protein binding; serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: negative regulation of angiogenesis; cellular protein metabolic process; proteolysis

Research Articles on KLK3

Similar Products

Product Notes

The KLK3 klk3 (Catalog #AAA6383731) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLK3 (APS, Prostate-specific Antigen, PSA, Gamma-seminoprotein, Seminin, Kallikrein-3, P-30 Antigen, Semenogelase) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLK3 klk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.