Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Neurotrypsin  Recombinant Protein | PRSS12 recombinant protein

Recombinant Human Neurotrypsin 

Gene Names
PRSS12; MRT1; BSSP3; BSSP-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurotrypsin ; Recombinant Human Neurotrypsin ; Leydin; Motopsin; Serine protease 12; PRSS12 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
631-874aa; partial
Sequence
IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for PRSS12 recombinant protein
Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.
Product Categories/Family for PRSS12 recombinant protein
References
"Cloning and sequencing of the cDNA encoding human neurotrypsin." Proba K., Gschwend T.P., Sonderegger P. Biochim. Biophys. Acta 1396:143-147(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.4 kDa
NCBI Official Full Name
neurotrypsin
NCBI Official Synonym Full Names
protease, serine 12
NCBI Official Symbol
PRSS12
NCBI Official Synonym Symbols
MRT1; BSSP3; BSSP-3
NCBI Protein Information
neurotrypsin
UniProt Protein Name
Neurotrypsin
Protein Family
UniProt Gene Name
PRSS12
UniProt Entry Name
NETR_HUMAN

NCBI Description

This gene encodes a member of the trypsin family of serine proteases. Studies in mouse suggest that the encoded enzyme may be involved in structural reorganizations associated with learning and memory. The enzyme is also expressed in Leydig cells in the testis, but its function in this tissue is unknown. Defects in this gene are a cause of mental retardation autosomal recessive type 1 (MRT1). [provided by RefSeq, Jul 2010]

Uniprot Description

PRSS12: Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations. Defects in PRSS12 are the cause of mental retardation autosomal recessive type 1 (MRT1). Mental retardation is a mental disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs. Belongs to the peptidase S1 family.

Protein type: EC 3.4.21.-; Vesicle; Secreted, signal peptide; Protease; Secreted

Chromosomal Location of Human Ortholog: 4q28.1

Cellular Component: axon; cytoplasmic vesicle; dendrite; plasma membrane; terminal button

Molecular Function: scavenger receptor activity; serine-type endopeptidase activity; serine-type peptidase activity

Biological Process: exocytosis; receptor-mediated endocytosis; zymogen activation

Disease: Mental Retardation, Autosomal Recessive 1

Research Articles on PRSS12

Similar Products

Product Notes

The PRSS12 prss12 (Catalog #AAA949101) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 631-874aa; partial. The amino acid sequence is listed below: IIGGKNSLRG GWPWQVSLRL KSSHGDGRLL CGATLLSSCW VLTAAHCFKR YGNSTRSYAV RVGDYHTLVP EEFEEEIGVQ QIVIHREYRP DRSDYDIALV RLQGPEEQCA RFSSHVLPAC LPLWRERPQK TASNCYITGW GDTGRAYSRT LQQAAIPLLP KRFCEERYKG RFTGRMLCAG NLHEHKRVDS CQGDSGGPLM CERPGESWVV YGVTSWGYGC GVKDSPGVYT KVSAFVPWIK SVTK . It is sometimes possible for the material contained within the vial of "Neurotrypsin , Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.