Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Protein BNLF2a (BNLF2a) Recombinant Protein | BNLF2a recombinant protein

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein BNLF2a (BNLF2a); Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a); Recombinant Protein BNLF2a (BNLF2a); Protein BNLF2a; BNLF2a recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-60
Sequence
MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI
Sequence Length
60
Species
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6,540 Da
NCBI Official Full Name
BNLF2a
NCBI Official Symbol
BNLF2a
NCBI Protein Information
BNLF2a
UniProt Protein Name
Protein BNLF2a
Protein Family
UniProt Entry Name
BNL2A_EBVB9

Uniprot Description

Function: Participates in viral evasion from HLA class I-restricted T-cell immunity. Associates with host TAP1 and TAP2 and prevents TAP-mediated peptide transport and subsequent loading. Ref.4

Subunit structure: Interacts with host TAP1 and TAP2. Ref.4

Subcellular location: Host endoplasmic reticulum membrane; Single-pass membrane protein

Potential.

Sequence similarities: Belongs to the lymphocryptovirus BNLF2a family.

Research Articles on BNLF2a

Similar Products

Product Notes

The BNLF2a (Catalog #AAA1125640) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-60. The amino acid sequence is listed below: MVHVLERALL EQQSSACGLP GSSTETRPSH PCPEDPDVSR LRLLLVVLCV LFGLLCLLLI. It is sometimes possible for the material contained within the vial of "Protein BNLF2a (BNLF2a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual