SDS-Page
Capsid protein VP26 Recombinant Protein | BFRF3 recombinant protein
Recombinant Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Capsid protein VP26
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Capsid protein VP26; Recombinant Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Capsid protein VP26; BFRF3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-176aa; Partial
Sequence
NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ
Sequence Length
176
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
References
DNA sequence and expression of the B95-8 Epstein-Barr virus genome.Baer R., Bankier A.T., Biggin M.D., Deininger P.L., Farrell P.J., Gibson T.J., Hatfull G., Hudson G.S., Satchwell S.C., Seguin C., Tuffnell P.S., Barrell B.G.Nature 310:207-211(1984)
The BamHI F region of the B95-8 Epstein-Barr virus genome.Hudson G.S., Gibson T.J., Barrell B.G.Virology 147:99-109(1985)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30.7 kDa
NCBI Official Full Name
capsid protein VP26
NCBI Official Symbol
BFRF3
NCBI Protein Information
capsid protein VP26
UniProt Protein Name
Capsid protein VP26
UniProt Gene Name
BFRF3
UniProt Entry Name
VP26_EBVB9
Uniprot Description
Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.
Research Articles on BFRF3
Similar Products
Product Notes
The BFRF3 bfrf3 (Catalog #AAA969674) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-176aa; Partial. The amino acid sequence is listed below: NQNNLPNDVF REAQRSYLVF LTSQFCYEEY VQRTFGVPRR QRAIDKRQRA SVAGAGAHAH LGGSSATPVQ QAQAAASAGT GALASSAPST AVAQSATPSV SSSISSLRAA TSGATAAASA AAAVDTGSGG GGQPHDTAPR GARKKQ. It is sometimes possible for the material contained within the vial of "Capsid protein VP26, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
