Probable lysosomal cobalamin transporter (NFIA_096740) Recombinant Protein | NFIA_096740 recombinant protein
Recombinant Neosartorya fischeri Probable lysosomal cobalamin transporter (NFIA_096740)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable lysosomal cobalamin transporter (NFIA_096740); Recombinant Neosartorya fischeri Probable lysosomal cobalamin transporter (NFIA_096740); Recombinant Probable lysosomal cobalamin transporter (NFIA_096740); Probable lysosomal cobalamin transporter; NFIA_096740 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-563
Sequence
MPLPWISLIWFAYLIVITVLIVVASVFIHVYQTPRDRSSFVTFMCVFSIAALLATVMLLPVDVALVSSTTSSALGQRKEWATQEEVDKITYSLTVIYYSLYFLDALLCLVGIPFAYFWHEEYDEVAFEAGDQTPCKRFWAATKYTLAFIAVVIALVLVGFFAPMSESQPGHDLGYWRGFLIENRGEHAFTFLLGFVTTIGSCLYVFYTPSGLALLPALFLRRSYSFANQTLVGSTAMQLDFNRERQRQLEGRCGGNSALLSPKDRRELDTLVREERTLIRRQRLIEGRQEEDQSWPVTVYSKLKTILRPFRLLGGFSLFLVGLSTWISLLMTVIDKLINSPCKHHCGYVLSRTNFNPISWLLIQSSRAFPTDYIIFALIVFLFFWGSVVGVVAVGIRFLWIRIFQIRKGHTSPQAMLLATAMLTLITLGLNYSVVMMLAPRYATFGPQTFCDLAPTSSEEQPDCSNHWHLVKPCSEKADSTAADNTCTPSVASTILNRVALNFPLFGALLLWAHFLFLGIYLVILVASLVRSPRLDERQLDEDAEEAEEESLLASTGRSGNPT
Sequence Length
563
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,398 Da
NCBI Official Full Name
LMBR1 domain protein, putative
NCBI Official Symbol
NFIA_096740
NCBI Protein Information
LMBR1 domain protein, putative
UniProt Protein Name
Probable lysosomal cobalamin transporter
UniProt Entry Name
LMBD1_NEOFI
Uniprot Description
Function: Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors
By similarity.
Subcellular location: Lysosome membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the LIMR family. LMBRD1 subfamily.
Similar Products
Product Notes
The NFIA_096740 (Catalog #AAA1003668) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-563. The amino acid sequence is listed below: MPLPWISLIW FAYLIVITVL IVVASVFIHV YQTPRDRSSF VTFMCVFSIA ALLATVMLLP VDVALVSSTT SSALGQRKEW ATQEEVDKIT YSLTVIYYSL YFLDALLCLV GIPFAYFWHE EYDEVAFEAG DQTPCKRFWA ATKYTLAFIA VVIALVLVGF FAPMSESQPG HDLGYWRGFL IENRGEHAFT FLLGFVTTIG SCLYVFYTPS GLALLPALFL RRSYSFANQT LVGSTAMQLD FNRERQRQLE GRCGGNSALL SPKDRRELDT LVREERTLIR RQRLIEGRQE EDQSWPVTVY SKLKTILRPF RLLGGFSLFL VGLSTWISLL MTVIDKLINS PCKHHCGYVL SRTNFNPISW LLIQSSRAFP TDYIIFALIV FLFFWGSVVG VVAVGIRFLW IRIFQIRKGH TSPQAMLLAT AMLTLITLGL NYSVVMMLAP RYATFGPQTF CDLAPTSSEE QPDCSNHWHL VKPCSEKADS TAADNTCTPS VASTILNRVA LNFPLFGALL LWAHFLFLGI YLVILVASLV RSPRLDERQL DEDAEEAEEE SLLASTGRSG NPT. It is sometimes possible for the material contained within the vial of "Probable lysosomal cobalamin transporter (NFIA_096740), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
