Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PRMT2 recombinant protein

PRMT2, Recombinant, Human (Protein arginine N-Methyltransferase 2, Histone-arginine N-methyltransferase PRMT2, HMT1, HRMT1L1)

Gene Names
PRMT2; HRMT1L1
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by affinity chromatography using glutathione sepharose
Synonyms
PRMT2; Recombinant; Human (Protein arginine N-Methyltransferase 2; Histone-arginine N-methyltransferase PRMT2; HMT1; HRMT1L1); PRMT2 recombinant protein
Ordering
For Research Use Only!
Purity/Purification
Affinity Purified
Purified by affinity chromatography using glutathione sepharose
Form/Format
Supplied as a liquid in 50mM Tris-HCI, 10mM reduced glutathione, pH 8.0
Sequence
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSAD
Applicable Applications for PRMT2 recombinant protein
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Preparation and Storage
Store at -70 degree C. Stable for at least 3 months at -70 degree C. Avoid freeze-thaw cycles. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for PRMT2 recombinant protein
PRMT2 (NP_001526.2, aa1-433) full-length recombinant protein with GST tag.

Arginine methylation is an irreversible post translational modification which has only recently been linked to protein activity. At least three types of PRMT enzymes have been identified in mammalian cells. These enzymes have been shown to have essential regulatory functions by methylation of key proteins in several fundamental areas. These protein include nuclear proteins, IL enhancer binding factor, nuclear factors, cell cycle proteins, signal transduction proteins, apoptosis proteins, and viral proteins. The mammalian PRMT family currently consists of 7 members that share two large domains of homology. Outside of these domains, epitopes were identified and antibodies against all 7 PRMT members have been developed.
Product Categories/Family for PRMT2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kD (theoretical)
NCBI Official Full Name
protein arginine N-methyltransferase 2 isoform 4
NCBI Official Synonym Full Names
protein arginine methyltransferase 2
NCBI Official Symbol
PRMT2
NCBI Official Synonym Symbols
HRMT1L1
NCBI Protein Information
protein arginine N-methyltransferase 2; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1
UniProt Protein Name
Protein arginine N-methyltransferase 2
UniProt Gene Name
PRMT2
UniProt Synonym Gene Names
HMT1; HRMT1L1
UniProt Entry Name
ANM2_HUMAN

Uniprot Description

PRMT2: Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1- dependent manner). May be involved in growth regulation. Belongs to the protein arginine N-methyltransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Nuclear receptor co-regulator; EC 2.1.1.125; Methyltransferase; Methyltransferase, protein arginine

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleoplasm; Rb-E2F complex; cytoplasm; nucleolus; cytosol; nucleus

Molecular Function: protein-arginine omega-N asymmetric methyltransferase activity; histone methyltransferase activity; protein-arginine N-methyltransferase activity; peroxisome proliferator activated receptor binding; protein homodimerization activity; retinoic acid receptor binding; transcription coactivator activity; histone-arginine N-methyltransferase activity; protein binding; signal transducer activity; androgen receptor binding; estrogen receptor binding; thyroid hormone receptor binding; progesterone receptor binding

Biological Process: histone methylation; developmental cell growth; protein amino acid methylation; inhibition of NF-kappaB transcription factor; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; peptidyl-arginine methylation, to asymmetrical-dimethyl arginine; signal transduction; negative regulation of transcription, DNA-dependent

Research Articles on PRMT2

Similar Products

Product Notes

The PRMT2 prmt2 (Catalog #AAA637370) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRMT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PRMT2 prmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATSGDCPRS ESQGEEPAEC SEAGLLQEGV QPEEFVAIAD YAATDETQLS FLRGEKILIL RQTTADWWWG ERAGCCGYIP ANHVGKHVDE YDPEDTWQDE EYFGSYGTLK LHLEMLADQP RTTKYHSVIL QNKESLTDKV ILDVGCGTGI ISLFCAHYAR PRAVYAVEAS EMAQHTGQLV LQNGFADIIT VYQQKVEDVV LPEKVDVLVS EWMGTCLLFE FMIESILYAR DAWLKEDGVI WPTMAALHLV PCSAD. It is sometimes possible for the material contained within the vial of "PRMT2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.