Prolactin-releasing peptide receptor (Prlhr) Recombinant Protein | Prlhr recombinant protein
Recombinant Rat Prolactin-releasing peptide receptor (Prlhr)
Gene Names
Prlhr; Gpr10; Uhr-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prolactin-releasing peptide receptor (Prlhr); Recombinant Rat Prolactin-releasing peptide receptor (Prlhr); Prlhr recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-370aa; full length protein
Sequence
MTSLPPGTTGDPDLFSGPSPAGSTPANQSAEASESNVSATVPRAAAVTPFQSLQLVHQLK GLIVMLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLKLSAYAV LGIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQIYAWGLLLGTYLLPLLA ILLSYVRVSVKLRNRVVPGSVTQSQADWDRARRRRTFCLLVVVVVVFALCWLPLHIFNLL RDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKMLLSWPRKIVPH GQNMTVSVVI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Prlhr recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,161 Da
NCBI Official Full Name
prolactin-releasing peptide receptor
NCBI Official Synonym Full Names
prolactin releasing hormone receptor
NCBI Official Symbol
Prlhr
NCBI Official Synonym Symbols
Gpr10; Uhr-1
NCBI Protein Information
prolactin-releasing peptide receptor
UniProt Protein Name
Prolactin-releasing peptide receptor
Protein Family
UniProt Gene Name
Prlhr
UniProt Synonym Gene Names
Gpr10; PrRP receptor; PrRPR
UniProt Entry Name
PRLHR_RAT
NCBI Description
putative receptor for prolactin-releasing peptide [RGD, Feb 2006]
Uniprot Description
GPR10: Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1
Cellular Component: integral to membrane; integral to plasma membrane
Molecular Function: G-protein coupled receptor activity; neuropeptide Y receptor activity; peptide hormone binding
Biological Process: cell surface receptor linked signal transduction; feeding behavior; G-protein coupled receptor protein signaling pathway; hormone metabolic process; neuropeptide signaling pathway
Research Articles on Prlhr
Similar Products
Product Notes
The Prlhr prlhr (Catalog #AAA7026956) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-370aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Prlhr prlhr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTSLPPGTTG DPDLFSGPSP AGSTPANQSA EASESNVSAT VPRAAAVTPF QSLQLVHQLK GLIVMLYSIV VVVGLVGNCL LVLVIARVRR LHNVTNFLIG NLALSDVLMC AACVPLTLAY AFEPRGWVFG GGLCHLVFFL QPVTVYVSVF TLTTIAVDRY VVLVHPLRRR ISLKLSAYAV LGIWALSAVL ALPAAVHTYH VELKPHDVRL CEEFWGSQER QRQIYAWGLL LGTYLLPLLA ILLSYVRVSV KLRNRVVPGS VTQSQADWDR ARRRRTFCLL VVVVVVFALC WLPLHIFNLL RDLDPRAIDP YAFGLVQLLC HWLAMSSACY NPFIYAWLHD SFREELRKML LSWPRKIVPH GQNMTVSVVI. It is sometimes possible for the material contained within the vial of "Prolactin-releasing peptide receptor (Prlhr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
