DNA-dependent protein kinase catalytic subunit (PRKDC) Recombinant Protein | PRKDC recombinant protein

Recombinant Human DNA-dependent protein kinase catalytic subunit (PRKDC) , partial

Cat. Num. AAA958970

• Gene Names: PRKDC; HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNA-PKcs
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-dependent protein kinase catalytic subunit (PRKDC); Recombinant Human DNA-dependent protein kinase catalytic subunit (PRKDC); partial; PRKDC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 3747-4015. Partial-length
• Sequence: EHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVPMTSRLGLIEWLENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTKMSGKHDVGAYMLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPEAFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHAFGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKN

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 126032350
• NCBI GeneID: 5591
• NCBI Accession #: NP_001075109.1
• NCBI GenBank Nucleotide #: NM_001081640.1
• UniProt Accession #: P78527; P78528; Q13327; Q13337; Q14175; Q59H99; Q7Z611; Q96SE6; Q9UME3
• Molecular Weight: 465,501 Da
• NCBI Official Full Name: DNA-dependent protein kinase catalytic subunit isoform 2
• NCBI Official Synonym Full Names: protein kinase, DNA-activated, catalytic polypeptide
• NCBI Official Symbol: PRKDC
• NCBI Official Synonym Symbols: HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNA-PKcs
• NCBI Protein Information: DNA-dependent protein kinase catalytic subunit
• UniProt Protein Name: DNA-dependent protein kinase catalytic subunit
• UniProt Gene Name: PRKDC
• UniProt Synonym Gene Names: HYRC; HYRC1; DNA-PK catalytic subunit; DNA-PKcs

NCBI Description

This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.[provided by RefSeq, Jul 2010]

Uniprot Description

Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D. Contributes to the determination of the circadian period length by antagonizing phosphorylation of CRY1 'Ser-588' and increasing CRY1 protein stability, most likely through an indirect mechanism. Interacts with CRY1 and CRY2; negatively regulates CRY1 phosphorylation. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.