Protein Kinase C Beta 1 (PKCb1) Recombinant Protein | PKCb1 recombinant protein
Recombinant Protein Kinase C Beta 1 (PKCb1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-FNFLMVLGK GSFGKVMLSE RKGTDELYAV KILKKDVVIQ DDDVECTMVE KRVLALPGKP PFLTQLHSCF QTMDRLYFVM EYVNGGDLMY HIQQVGRFKE PHAVFYAAEI AIGLFFLQSK GIIYRDLKLD NVMLDSEGHI KIADFGMCKE NIWDGVTTKT FCGTPDYIAP EIIAYQPYGK SVDWWAFGVL LYEMLAGQAP FEGEDEDELF QSIMEHNVAY PKSMSKEAVA ICKGLMTKHP GKRLGCGPEG ERDIKEHAFF
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
plays a role in hexosamine biosynthesis pathway induced transcriptional regulation [RGD, Feb 2006]
Uniprot Description
PKCB: an AGC kinase of the PKC family. A classical PKC downstream of many mitogenic receptors. Activates the NF-kappaB signaling pathway in B cells after antigen-receptor signaling. Two splice-variant isoforms have been described.
Protein type: Protein kinase, AGC; Kinase, protein; Motility/polarity/chemotaxis; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.13; AGC group; PKC family; Alpha subfamily
Cellular Component: centrosome; membrane; brush border membrane; cytoplasm; plasma membrane; cytosol; nucleus
Molecular Function: protein serine/threonine kinase activity; protein binding; protein kinase C activity; protein kinase C binding; ligand-dependent nuclear receptor transcription coactivator activity; androgen receptor binding; zinc ion binding; histone binding; calcium channel regulator activity; chromatin binding; ATP binding
Biological Process: response to drug; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; B cell activation; dibenzo-p-dioxin metabolic process; apoptosis; positive regulation of B cell receptor signaling pathway; negative regulation of insulin receptor signaling pathway; positive regulation of odontogenesis of dentine-containing teeth; regulation of dopamine secretion; protein amino acid phosphorylation; positive regulation of vascular endothelial growth factor receptor signaling pathway; activation of NF-kappaB transcription factor; regulation of transcription from RNA polymerase II promoter; cellular calcium ion homeostasis; positive regulation of angiogenesis; B cell receptor signaling pathway; response to ethanol; response to vitamin D; regulation of growth; calcium ion transport; response to glucose stimulus; response to hypoxia
Research Articles on PKCb1
Similar Products
Product Notes
The PKCb1 prkcb (Catalog #AAA2010956) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Protein Kinase C Beta 1 (PKCb1) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the PKCb1 prkcb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS -FNFLMVLGK GSFGKVMLSE RKGTDELYAV KILKKDVVIQ DDDVECTMVE KRVLALPGKP PFLTQLHSCF QTMDRLYFVM EYVNGGDLMY HIQQVGRFKE PHAVFYAAEI AIGLFFLQSK GIIYRDLKLD NVMLDSEGHI KIADFGMCKE NIWDGVTTKT FCGTPDYIAP EIIAYQPYGK SVDWWAFGVL LYEMLAGQAP FEGEDEDELF QSIMEHNVAY PKSMSKEAVA ICKGLMTKHP GKRLGCGPEG ERDIKEHAFF. It is sometimes possible for the material contained within the vial of "Protein Kinase C Beta 1 (PKCb1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
