(Rhesus macaque) cAMP-dependent protein kinase catalytic subunit gamma (PRKACG) Recombinant Protein | PRKACG recombinant protein
Recombinant Macaca mulatta (Rhesus macaque) cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) cAMP-dependent protein kinase catalytic subunit gamma (PRKACG); Recombinant Macaca mulatta (Rhesus macaque) cAMP-dependent protein kinase catalytic subunit gamma (PRKACG); Recombinant (Rhesus macaque) cAMP-dependent protein kinase catalytic subunit gamma (PRKACG); cAMP-dependent protein kinase catalytic subunit gamma; PKA C-gamma EC= 2.7.11.11; PRKACG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-209
Sequence
GNAAAKKDTEQETVNEFLAKARGDFLYRWGNPAQNTASSDQFERLKTLGTGSYGRVMLVRHRETGNHYAMKILDKQKVVRLKQVEHTLNEKRILQAINFPFLVKLQFSFKDNSNLYLVMEYVPGGEMFSHLRRVGRFSEPQACFYAAQVVLAFQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEI
Sequence Length
209
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
24,096 Da
NCBI Official Full Name
cAMP-dependent protein kinase catalytic subunit gamma
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit gamma
Protein Family
UniProt Gene Name
PRKACG
UniProt Synonym Gene Names
PKA C-gamma
UniProt Entry Name
KAPCG_MACMU
Uniprot Description
Function: Phosphorylates a large number of substrates in the cytoplasm and the nucleus.
Catalytic activity: ATP + a protein = ADP + a phosphoprotein.
Enzyme regulation: Activated by cAMP.
Subunit structure: A number of inactive tetrameric holoenzymes are produced by the combination of homo- or heterodimers of the different regulatory subunits associated with two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits.
Tissue specificity: Testis specific.
Sequence similarities: Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.Contains 1 protein kinase domain.
Similar Products
Product Notes
The (Rhesus macaque) cAMP-dependent protein kinase catalytic subunit gamma (PRKACG) prkacg (Catalog #AAA1164505) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-209. The amino acid sequence is listed below: GNAAAKKDTE QETVNEFLAK ARGDFLYRWG NPAQNTASSD QFERLKTLGT GSYGRVMLVR HRETGNHYAM KILDKQKVVR LKQVEHTLNE KRILQAINFP FLVKLQFSFK DNSNLYLVME YVPGGEMFSH LRRVGRFSEP QACFYAAQVV LAFQYLHSLD LIHRDLKPEN LLIDQQGYLQ VTDFGFAKRV KGRTWTLCGT PEYLAPEI. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) cAMP-dependent protein kinase catalytic subunit gamma (PRKACG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
