SDS-PAGE
S-norcoclaurine synthase 2 Recombinant Protein | PR10A recombinant protein
Recombinant Coptis japonica (Japanese goldthread) S-norcoclaurine synthase 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
S-norcoclaurine synthase 2; Recombinant Coptis japonica (Japanese goldthread) S-norcoclaurine synthase 2; Pathogenesis related protein 10A; CjPR10A; PR10A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-196. Full Length of Mature Protein
Sequence
ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for PR10A recombinant protein
Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate.
References
Functional analysis of norcoclaurine synthase in Coptis japonica.Minami H., Dubouzet E., Iwasa K., Sato F.J. Biol. Chem. 282:6274-6282(2007)
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
S-norcoclaurine synthase 2
UniProt Protein Name
S-norcoclaurine synthase 2
Protein Family
UniProt Gene Name
PR10A
UniProt Synonym Gene Names
CjPR10A
UniProt Entry Name
NCS2_COPJA
Uniprot Description
Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate.
Similar Products
Product Notes
The PR10A pr10a (Catalog #AAA1224505) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-196. Full Length of Mature Protein. The amino acid sequence is listed below: ERLIFNGRPL LHRVTKEETV MLYHELEVAA SADEVWSVEG SPELGLHLPD LLPAGIFAKF EITGDGGEGS ILDMTFPPGQ FPHHYREKFV FFDHKNRYKL VEQIDGDFFD LGVTYYMDTI RVVATGPDSC VIKSTTEYHV KPEFAKIVKP LIDTVPLAIM SEAIAKVVLE NKHKSSE . It is sometimes possible for the material contained within the vial of "S-norcoclaurine synthase 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
