Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform Recombinant Protein | PPP2CB recombinant protein

Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

Gene Names
PPP2CB; PP2CB; PP2Abeta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PPP2CB recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-309aa; Full Length
Sequence
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Sequence Length
309
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for PPP2CB recombinant protein
PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
Product Categories/Family for PPP2CB recombinant protein
References
The nucleotide sequence of the cDNA encoding the human lung protein phosphatase 2A beta catalytic subunit.Hemmings B.A., Wernet W., Mayer R., Maurer F., Hofsteenge J., Stone S.R.Nucleic Acids Res. 16:11366-11366(1988)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62.6 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
NCBI Official Synonym Full Names
protein phosphatase 2 catalytic subunit beta
NCBI Official Symbol
PPP2CB
NCBI Official Synonym Symbols
PP2CB; PP2Abeta
NCBI Protein Information
serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
UniProt Gene Name
PPP2CB
UniProt Synonym Gene Names
PP2A-beta
UniProt Entry Name
PP2AB_HUMAN

NCBI Description

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. [provided by RefSeq, Mar 2010]

Uniprot Description

PPP2CB: one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits.

Protein type: EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: chromosome, pericentric region; cytosol; nucleus; protein phosphatase type 2A complex; spindle pole

Molecular Function: metal ion binding; protein binding; protein C-terminus binding; protein serine/threonine phosphatase activity

Biological Process: apoptotic mitochondrial changes; fibroblast growth factor receptor signaling pathway; negative regulation of Ras protein signal transduction; proteasomal ubiquitin-dependent protein catabolic process; protein amino acid dephosphorylation; regulation of gene expression; response to antibiotic; response to hydrogen peroxide

Research Articles on PPP2CB

Similar Products

Product Notes

The PPP2CB ppp2cb (Catalog #AAA717223) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-309aa; Full Length. The amino acid sequence is listed below: MDDKAFTKEL DQWVEQLNEC KQLNENQVRT LCEKAKEILT KESNVQEVRC PVTVCGDVHG QFHDLMELFR IGGKSPDTNY LFMGDYVDRG YYSVETVTLL VALKVRYPER ITILRGNHES RQITQVYGFY DECLRKYGNA NVWKYFTDLF DYLPLTALVD GQIFCLHGGL SPSIDTLDHI RALDRLQEVP HEGPMCDLLW SDPDDRGGWG ISPRGAGYTF GQDISETFNH ANGLTLVSRA HQLVMEGYNW CHDRNVVTIF SAPNYCYRCG NQAAIMELDD TLKYSFLQFD PAPRRGEPHV TRRTPDYFL. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.