Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) Recombinant Protein | PPP1CB recombinant protein

Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB)

Cat. Num. AAA965220

• Gene Names: PPP1CB; PP1B; PP-1B; PPP1CD; PP1beta; HEL-S-80p
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB); Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB); Serine/threonine-protein phosphatase PP1-beta catalytic subunit; PP-1B; PPP1CD; EC=3.1.3.16; EC=3.1.3.53; PPP1CB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-327aa; Full Length of Mature Protein
• Sequence: ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
• Sequence Length: 326

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for PPP1CB recombinant protein

Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).

Product Categories/Family for PPP1CB recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 4506005
• NCBI GeneID: 5500
• NCBI Accession #: NP_002700.1
• NCBI GenBank Nucleotide #: NM_002709.2
• UniProt Accession #: P62140; P37140; Q5U087; Q6FG45; B2R5V4; D6W565
• Molecular Weight: 41.1 kDa
• NCBI Official Full Name: serine/threonine-protein phosphatase PP1-beta catalytic subunit isoform 1
• NCBI Official Synonym Full Names: protein phosphatase 1, catalytic subunit, beta isozyme
• NCBI Official Symbol: PPP1CB
• NCBI Official Synonym Symbols: PP1B; PP-1B; PPP1CD; PP1beta; HEL-S-80p
• NCBI Protein Information: serine/threonine-protein phosphatase PP1-beta catalytic subunit; protein phosphatase 1-beta; protein phosphatase 1-delta; epididymis secretory sperm binding protein Li 80p; protein phosphatase 1, catalytic subunit, beta isoform; protein phosphatase 1, catalytic subunit, delta isoform; serine/threonine protein phosphatase PP1-beta catalytic subunit
• UniProt Protein Name: Serine/threonine-protein phosphatase PP1-beta catalytic subunit
• Protein Family: Serine/threonine-protein phosphatase
• UniProt Gene Name: PPP1CB
• UniProt Synonym Gene Names: PP-1B; PPP1CD
• UniProt Entry Name: PP1B_HUMAN

NCBI Description

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

PPP1CB: is a catalytic subunit of protein phosphatase 1 (PP1), a ubiquitous cytosolic serine-threonine phosphatase. Composed a catalytic subunit (PPP1CA, PPP1CB or PPP1CC) which is folded into its native form by inhibitor 2 and glycogen synthetase kinase 3, and then complexed to one or several targeting (or regulatory) subunits: PPP1R12A and PPP1R12B mediate binding to myosin; PPP1R3A, PPP1R3B, PPP1R3C and PPP1R3D mediate binding to glycogen; and PPP1R15A and PPP1R15B mediate binding to EIF2S1. PP1 is essential for cell division, plays critical roles in many cellular processes including glycogen metabolism, muscle contractility and protein synthesis, and is involved in the regulation of ionic conductances and long-term synaptic plasticity. Inhibits the synthesis of proteins involved in synaptic plasticity. Binds to the transcription factor cyclic AMP-dependent response element binding (CREB) and dephosphorylates it. May regulate chromatin condensation through regulation of histone H3 phosphorylation. Differentially expressed in gastric cancer. May participate in the neurodegenerative progress in Alzheimer's disease. Down-regulated in lung squamous cell carcinoma.

Protein type: Motility/polarity/chemotaxis; EC 3.1.3.16; EC 3.1.3.53; Protein phosphatase, Ser/Thr (non-receptor); Nucleolus

Chromosomal Location of Human Ortholog: 2p23

Cellular Component: nucleoplasm; focal adhesion; glycogen granule; nucleolus; protein phosphatase type 1 complex; nucleus

Molecular Function: protein binding; myosin-light-chain-phosphatase activity; metal ion binding; phosphoric monoester hydrolase activity; myosin phosphatase activity; protein kinase binding

Biological Process: regulation of cell adhesion; glycogen metabolic process; regulation of glycogen biosynthetic process; regulation of circadian rhythm; protein amino acid dephosphorylation; entrainment of circadian clock by photoperiod; regulation of glycogen catabolic process; cell division; transforming growth factor beta receptor signaling pathway; triacylglycerol catabolic process; circadian regulation of gene expression; mitotic cell cycle; negative regulation of transforming growth factor beta receptor signaling pathway; G2/M transition of mitotic cell cycle