Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Suppressor of SWI4 1 homolog (PPAN) Recombinant Protein | PPAN recombinant protein

Recombinant Human Suppressor of SWI4 1 homolog (PPAN)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Suppressor of SWI4 1 homolog (PPAN); Recombinant Human Suppressor of SWI4 1 homolog (PPAN); PPAN recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-473aa, full length protein
Sequence
MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA
Sequence Length
520
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Related Product Information for PPAN recombinant protein
This protein is an evolutionarily conserved protein similar to yeast SSF1 as well as to the gene product of the Drosophila gene peter pan (ppan). SSF1 is known to be involved in the second step of mRNA splicing. Both SSF1 and ppan are essential for cell growth and proliferation. This gene was found to cotranscript with P2RY11
P2Y(11), an immediate downstream gene on the chromosome that encodes a ATP receptor. The chimeric transcripts of this gene and P2RY11 were found to be ubiquitously present and regulated during granulocytic differentiation. Exogenous expression of this gene was reported to reduce the anchorage-independent growth of some tumor cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55.2 kDa
NCBI Official Full Name
PPAN-P2RY11 protein isoform 1
NCBI Official Synonym Full Names
PPAN-P2RY11 readthrough
NCBI Official Symbol
PPAN-P2RY11
NCBI Protein Information
PPAN-P2RY11 protein
UniProt Protein Name
Suppressor of SWI4 1 homolog
Protein Family
UniProt Gene Name
PPAN
UniProt Synonym Gene Names
BXDC3; SSF1; Ssf-1

NCBI Description

This locus represents naturally occurring read-through transcription between the adjacent PPAN and P2RY11 genes. Alternative splicing results in two transcript variants, one of which encodes a fusion protein that shares sequence identity with each individual gene product. This transcript is found to be ubiquitously expressed and is up-regulated by agents inducing granulocytic differentiation. However, its functional significance in vivo remains unclear. [provided by RefSeq, Nov 2010]

Uniprot Description

May have a role in cell growth.MiscellaneousA chimeric transcript, characterized by the first third of PPAN exon 12 joined to P2RY11 exon 2, has been detected. It is possibly produced by trans-splicing. The chimeric transcript is widely expressed and can be induced by retinoic acid during the granulocytic differentiation of the HL-60 cell line. The resulting chimeric protein shows a much lower activity than the non-chimeric P2RY11 gene product, but qualitatively indistinguishable (PubMed:11278528).

Similar Products

Product Notes

The PPAN ppan (Catalog #AAA1380223) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-473aa, full length protein. The amino acid sequence is listed below: MGQSGRSRHQ KRARAQAQLR NLEAYAANPH SFVFTRGCTG RNIRQLSLDV RRVMEPLTAS RLQVRKKNSL KDCVAVAGPL GVTHFLILSK TETNVYFKLM RLPGGPTLTF QVKKYSLVRD VVSSLRRHRM HEQQFAHPPL LVLNSFGPHG MHVKLMATMF QNLFPSINVH KVNLNTIKRC LLIDYNPDSQ ELDFRHYSIK VVPVGASRGM KKLLQEKFPN MSRLQDISEL LATGAGLSES EAEPDGDHNI TELPQAVAGR GNMRAQQSAV RLTEIGPRMT LQLIKVQEGV GEGKVMFHSF VSKTEEELQA ILEAKEKKLR LKAQRQAQQA QNVQRKQEQR EAHRKKSLEG MKKARVGGSD EEASGIPSRT ASLELGEDDD EQEDDDIEYF CQAVGEAPSE DLFPEAKQKR LAKSPGRKRK RWEMDRGRGR LCDQKFPKTK DKSQGAQARR GPRGASRDGG RGRGRGRPGK RVA. It is sometimes possible for the material contained within the vial of "Suppressor of SWI4 1 homolog (PPAN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.