Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Serum paraoxonase/arylesterase 2 (PON2) Recombinant Protein | PON2 recombinant protein

Recombinant Chicken Serum paraoxonase/arylesterase 2 (PON2)

Gene Names
PON2; PON1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serum paraoxonase/arylesterase 2 (PON2); Recombinant Chicken Serum paraoxonase/arylesterase 2 (PON2); PON2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354, Full length protein
Sequence
MGKVLAAALVGIAAALAAERLLAFRNRLNATREVDPVALPNCYLIKGIETGSEDIDILPNGLAFISSGLKYPGLKSFAPDKPGEIFLMDLNEKKPKASELRISRGFDVGSFNPHGISTYIDKDDTVYLFVVNHPHQKSTVELFKFMEDDNSLVHLKTIRHDLLTSVNDVVAVGPDSFYATNDHYFYDFILMFLEMYLGLTWSNVVYYSPKEVKEVAAGFYSANGINISPDKKYIYIADILDHNVHVMEKHADWNLTHVKTLQLDTLADNLSVDPDTGDIWTGCHPNGMKLFYDDPDNPPASEVLRIQNILAEQPTVTRVYAENGSVLQGTSVATVYDGKLLIGTVFHRALYCEL
Sequence Length
354
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PON2 recombinant protein
This gene encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded protein may also play a role in defense responses to pathogenic bacteria. Mutations in this gene may be associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively spliced transcript variants encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,409 Da
NCBI Official Full Name
Serum paraoxonase/arylesterase 2
NCBI Official Synonym Full Names
paraoxonase 2
NCBI Official Symbol
PON2
NCBI Official Synonym Symbols
PON1
NCBI Protein Information
serum paraoxonase/arylesterase 2
UniProt Protein Name
Serum paraoxonase/arylesterase 2
UniProt Gene Name
PON2
UniProt Synonym Gene Names
PON 2; A-esterase 2

Uniprot Description

The absence of paraoxonase activity in turkey and chicken blood and in turkey liver indicates that PON2, if expressed, does not hydrolyze paraoxon.

Similar Products

Product Notes

The PON2 pon2 (Catalog #AAA1326802) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354, Full length protein. The amino acid sequence is listed below: MGKVLAAALV GIAAALAAER LLAFRNRLNA TREVDPVALP NCYLIKGIET GSEDIDILPN GLAFISSGLK YPGLKSFAPD KPGEIFLMDL NEKKPKASEL RISRGFDVGS FNPHGISTYI DKDDTVYLFV VNHPHQKSTV ELFKFMEDDN SLVHLKTIRH DLLTSVNDVV AVGPDSFYAT NDHYFYDFIL MFLEMYLGLT WSNVVYYSPK EVKEVAAGFY SANGINISPD KKYIYIADIL DHNVHVMEKH ADWNLTHVKT LQLDTLADNL SVDPDTGDIW TGCHPNGMKL FYDDPDNPPA SEVLRIQNIL AEQPTVTRVY AENGSVLQGT SVATVYDGKL LIGTVFHRAL YCEL. It is sometimes possible for the material contained within the vial of "Serum paraoxonase/arylesterase 2 (PON2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.