Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human ZNRD1 Polyclonal Antibody | anti-ZNRD1 antibody

ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12, Zinc Ribbon Domain-containing Protein 1, RPA12, MGC13376) (MaxLight 405)

Gene Names
POLR1H; TEX6; ZR14; A12.2; HTEX6; Rpa12; ZNRD1; hZR14; HTEX-6; TCTEX6; tctex-6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNRD1; Polyclonal Antibody; ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12; Zinc Ribbon Domain-containing Protein 1; RPA12; MGC13376) (MaxLight 405); anti-ZNRD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNRD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
126
Applicable Applications for anti-ZNRD1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ZNRD1, aa1-126 (NP_055411.1).
Immunogen Sequence
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ZNRD1 antibody
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.
Product Categories/Family for anti-ZNRD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
DNA-directed RNA polymerase I subunit RPA12
NCBI Official Synonym Full Names
RNA polymerase I subunit H
NCBI Official Symbol
POLR1H
NCBI Official Synonym Symbols
TEX6; ZR14; A12.2; HTEX6; Rpa12; ZNRD1; hZR14; HTEX-6; TCTEX6; tctex-6
NCBI Protein Information
DNA-directed RNA polymerase I subunit RPA12
UniProt Protein Name
DNA-directed RNA polymerase I subunit RPA12
UniProt Gene Name
ZNRD1
UniProt Synonym Gene Names
RPA12
UniProt Entry Name
RPA12_HUMAN

NCBI Description

This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

ZNRD1: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.

Protein type: Nucleolus; Transcription initiation complex; Transferase

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; DNA-directed RNA polymerase I complex

Molecular Function: nucleic acid binding; zinc ion binding

Biological Process: negative regulation of gene expression, epigenetic; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic

Research Articles on ZNRD1

Similar Products

Product Notes

The ZNRD1 znrd1 (Catalog #AAA6399310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12, Zinc Ribbon Domain-containing Protein 1, RPA12, MGC13376) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNRD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNRD1 znrd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNRD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.