Mouse anti-Human ZNHIT1 Polyclonal Antibody | anti-ZNHIT1 antibody

ZNHIT1 (Zinc Finger HIT Domain-containing Protein 1, Cyclin-G1-binding Protein 1, CGBP1, p18 Hamlet, Zinc Finger Protein Subfamily 4A Member 1, ZNFN4A1)

Cat. Num. AAA6009789

• Gene Names: ZNHIT1; CG1I; ZNFN4A1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNHIT1; Polyclonal Antibody; ZNHIT1 (Zinc Finger HIT Domain-containing Protein 1; Cyclin-G1-binding Protein 1; CGBP1; p18 Hamlet; Zinc Finger Protein Subfamily 4A Member 1; ZNFN4A1); Anti -ZNHIT1 (Zinc Finger HIT Domain-containing Protein 1; anti-ZNHIT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNHIT1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

• Applicable Applications for anti-ZNHIT1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full-length human ZNHIT1, aa1-154 (NP_006340.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNHIT1 expression in transfected 293T cell line by ZNHIT1 polyclonal antibody. Lane 1: ZNHIT1 transfected lysate (16.94kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-ZNHIT1 antibody

Antibodies; Abs to Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 5453617
• NCBI GeneID: 10467
• NCBI Accession #: NP_006340.1
• NCBI GenBank Nucleotide #: NM_006349.2
• UniProt Accession #: O43257; Q6IB12
• Molecular Weight: 17,536 Da
• NCBI Official Full Name: zinc finger HIT domain-containing protein 1
• NCBI Official Synonym Full Names: zinc finger, HIT-type containing 1
• NCBI Official Symbol: ZNHIT1
• NCBI Official Synonym Symbols: CG1I; ZNFN4A1
• NCBI Protein Information: zinc finger HIT domain-containing protein 1; p18Hamlet; p18 Hamlet; H_DJ0747G18.14; zinc finger, HIT type 1; cyclin-G1-binding protein 1; zinc finger, HIT domain containing 1; putative cyclin G1 interacting protein; zinc finger protein subfamily 4A member 1; zinc finger protein, subfamily 4A (HIT domain containing), member 1
• UniProt Protein Name: Zinc finger HIT domain-containing protein 1
• Protein Family: Zinc finger HIT domain-containing protein
• UniProt Gene Name: ZNHIT1
• UniProt Synonym Gene Names: CGBP1; ZNFN4A1
• UniProt Entry Name: ZNHI1_HUMAN

Uniprot Description

ZNHIT1: Seems to play a role in p53-mediated apoptosis induction. Belongs to the ZNHIT1 family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: nucleus

Molecular Function: protein binding; metal ion binding; histone deacetylase binding; nucleosome binding

Biological Process: regulation of histone deacetylation; regulation of T cell proliferation; histone exchange; negative regulation of transcription from RNA polymerase II promoter