Western Blot (WB)
(Western Blot analysis of ZNF75A expression in transfected 293T cell line by ZNF75A polyclonal antibody. Lane 1: ZNF75A transfected lysate (32.56kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human ZNF75A Polyclonal Antibody | anti-ZNF75A antibody
ZNF75A (Zinc Finger Protein 75a)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZNF75A; Polyclonal Antibody; ZNF75A (Zinc Finger Protein 75a); Anti -ZNF75A (Zinc Finger Protein 75a); anti-ZNF75A antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF75A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQRIHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Applicable Applications for anti-ZNF75A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ZNF75A, aa1-296 (NP_694573.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of ZNF75A expression in transfected 293T cell line by ZNF75A polyclonal antibody. Lane 1: ZNF75A transfected lysate (32.56kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ZNF75A expression in transfected 293T cell line by ZNF75A polyclonal antibody. Lane 1: ZNF75A transfected lysate (32.56kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ZNF75A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
ZNF75A protein
NCBI Official Synonym Full Names
zinc finger protein 75a<
NCBI Official Symbol
ZNF75A
NCBI Protein Information
zinc finger protein 75A
Protein Family
Similar Products
Product Notes
The ZNF75A (Catalog #AAA648578) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF75A (Zinc Finger Protein 75a) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF75A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ZNF75A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYFSQEEWEL LDPTQKALYN DVMQENYETV ISLALFVLPK PKVISCLEQG EEPWVQVSPE FKDSAGKSPT GLKLKNDTEN HQPVSLSDLE IQASAGVISK KAKVKVPQKT AGKENHFDMH RVGKWHQDFP VKKRKKLSTW KQELLKLMDR HKKDCAREKP FKCQECGKTF RVSSDLIKHQ RIHTEEKPYK CQQCDKRFRW SSDLNKHLTT HQGIKPYKCS WCGKSFSQNT NLHTHQRTHT GEKPFTCHEC GKKFSQNSHL IKHRRTHTGE QPYTCSICRR NFSRRSSLLR HQKLHL. It is sometimes possible for the material contained within the vial of "ZNF75A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
