Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ZCCHC3 expression in transfected 293T cell line by ZCCHC3 polyclonal antibody. Lane 1: ZCCHC3 transfected lysate (44.33kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ZCCHC3 Polyclonal Antibody | anti-ZCCHC3 antibody

ZCCHC3 (Zinc Finger CCHC Domain-containing Protein 3, C20orf99)

Gene Names
ZCCHC3; C20orf99
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZCCHC3; Polyclonal Antibody; ZCCHC3 (Zinc Finger CCHC Domain-containing Protein 3; C20orf99); Anti -ZCCHC3 (Zinc Finger CCHC Domain-containing Protein 3; anti-ZCCHC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZCCHC3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MATGGGAEEERKRGRPQLLPPARPAARGEEADGGREKMGWAQVVKNLAEKKGEFREPRPPRREEESGGGGGSAGLGGPAGLAAPDLGDFPPAGRGDPKGRRRDPAGEAVDPRKKKGAAEAGRRKKAEAAAAAMATPARPGEAEDAAERPLQDEPAAAAGPGKGRFLVRICFQGDEGACPTRDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH
Applicable Applications for anti-ZCCHC3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ZCCHC3, aa1-403 (NP_149080).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZCCHC3 expression in transfected 293T cell line by ZCCHC3 polyclonal antibody. Lane 1: ZCCHC3 transfected lysate (44.33kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZCCHC3 expression in transfected 293T cell line by ZCCHC3 polyclonal antibody. Lane 1: ZCCHC3 transfected lysate (44.33kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ZCCHC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43,618 Da
NCBI Official Full Name
ZCCHC3 protein
NCBI Official Synonym Full Names
zinc finger, CCHC domain containing 3
NCBI Official Symbol
ZCCHC3
NCBI Official Synonym Symbols
C20orf99
NCBI Protein Information
zinc finger CCHC domain-containing protein 3
UniProt Protein Name
Zinc finger CCHC domain-containing protein 3
UniProt Gene Name
ZCCHC3
UniProt Synonym Gene Names
C20orf99
UniProt Entry Name
ZCHC3_HUMAN

Uniprot Description

ZCCHC3: a zinc-finger protein containing 3 CCHC-type zinc fingers.

Protein type: RNA-binding; DNA-binding

Chromosomal Location of Human Ortholog: 20p13-p12.2

Molecular Function: zinc ion binding

Similar Products

Product Notes

The ZCCHC3 zcchc3 (Catalog #AAA6002762) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZCCHC3 (Zinc Finger CCHC Domain-containing Protein 3, C20orf99) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZCCHC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ZCCHC3 zcchc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATGGGAEEE RKRGRPQLLP PARPAARGEE ADGGREKMGW AQVVKNLAEK KGEFREPRPP RREEESGGGG GSAGLGGPAG LAAPDLGDFP PAGRGDPKGR RRDPAGEAVD PRKKKGAAEA GRRKKAEAAA AAMATPARPG EAEDAAERPL QDEPAAAAGP GKGRFLVRIC FQGDEGACPT RDFVVGALIL RSIGMDPSDI YAVIQIPGSR EFDVSFRSAE KLALFLRVYE EKREQEDCWE NFVVLGRSKS SLKTLFILFR NETVDVEDIV TWLKRHCDVL AVPVKVTDRF GIWTGEYKCE IELRQGEGGV RHLPGAFFLG AERGYSWYKG QPKTCFKCGS RTHMSGSCTQ DRCFRCGEEG HLSPYCRKGI VCNLCGKRGH AFAQCPKAVH NSVAAQLTGV AGH. It is sometimes possible for the material contained within the vial of "ZCCHC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.