Western Blot (WB)
(WB Suggested Anti-ZNF711 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Rabbit ZNF711 Polyclonal Antibody | anti-ZNF711 antibody
ZNF711 antibody - N-terminal region
Gene Names
ZNF711; ZNF4; ZNF5; ZNF6; CMPX1; MRX97; Zfp711; dJ75N13.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF711; Polyclonal Antibody; ZNF711 antibody - N-terminal region; anti-ZNF711 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEI
Sequence Length
761
Applicable Applications for anti-ZNF711 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF711
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF711 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZNF711 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-ZNF711 antibody
This is a rabbit polyclonal antibody against ZNF711. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF711 may be involved in transcriptional regulation.This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptional activator. This gene lies in a region of the X chromosome which has been associated with mental retardation.
Target Description: ZNF711 may be involved in transcriptional regulation.This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptional activator. This gene lies in a region of the X chromosome which has been associated with mental retardation.
Product Categories/Family for anti-ZNF711 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
zinc finger protein 711 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 711
NCBI Official Symbol
ZNF711
NCBI Official Synonym Symbols
ZNF4; ZNF5; ZNF6; CMPX1; MRX97; Zfp711; dJ75N13.1
NCBI Protein Information
zinc finger protein 711
UniProt Protein Name
Zinc finger protein 711
Protein Family
UniProt Gene Name
ZNF711
UniProt Synonym Gene Names
CMPX1; ZNF6
UniProt Entry Name
ZN711_HUMAN
NCBI Description
This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptional activator. This gene lies in a region of the X chromosome which has been associated with cognitive disability. [provided by RefSeq, Jul 2008]
Research Articles on ZNF711
Similar Products
Product Notes
The ZNF711 znf711 (Catalog #AAA3201564) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF711 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF711 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF711 znf711 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEHMGNTPLK IGSDGSQEDA KEDGFGSEVI KVYIFKAEAE DDVEIGGTEI. It is sometimes possible for the material contained within the vial of "ZNF711, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
